KEGG   Aspergillus niger: ANI_1_674084Help
Entry
ANI_1_674084      CDS       T01030                                 

Gene name
An09g05380
Definition
translation initiation factor eIF4E3
Orthology
K03259  
translation initiation factor 4E
Organism
ang  Aspergillus niger
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ANI_1_674084 (An09g05380)
Translation factors [BR:ang03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ANI_1_674084 (An09g05380)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 352 aa AA seqDB search
MDNANLWTRRSNTSKLSLSMTGTDGARVELPRATKRFGPDSSHGGRSNPFNALSPLSGGV
SSPSTNASSAFGLGSGAFASFGTPKTPGAPSDLKTPGEKRENPVDQVSAAEAGKPKGAAL
TLKEHPLKSTWIIWYRPPTPKYSDYEKSTAPLASISSVESFWSIYSHLKRPSLLPTVSDY
HIFKKGIRPVWEDEANKRGGKWVVRLKKGVADRYWEDLLLAMIGDQFAEASDEVCGAVLS
VRSGEDVLNVWTRIDGGRNIKIRETIKRLLNFPADTNIVWKSHDDSIAQRSAIDQARQEK
AAGNAGHHHHHHHHHHHHNNNNNHNHNQQNQLGDRRRVTANDEGDKGKGTTS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggataacgcaaacctctggactcgccgatccaacacctccaagttgtctctgtctatg
acggggacggacggcgctcgagttgaacttccccgcgccaccaagcgtttcggccccgac
agctcccacggcggccggtccaaccctttcaacgccctctcccccctctccggcggcgtg
tcctctccgtctacaaacgcctcctctgcattcggcctgggctccggtgcctttgcgtcg
tttggaacccccaaaacccccggtgcaccttccgacctgaaaactcccggcgagaagcgt
gaaaaccctgtcgaccaggtttccgctgctgaggccggcaaacctaagggcgctgccttg
acgctcaaggagcacccgctcaagtccacttggattatctggtaccggcctcccacacct
aaatactccgattacgaaaagtctaccgctccgcttgcatccatatcatcagtagagagt
ttctggtcgatctattcgcacctaaagaggccctctctgctccccacagtctccgactac
catatcttcaaaaagggcatccgtccggtatgggaggacgaggccaataagagaggtgga
aaatgggtggtgaggctgaagaagggggttgcggatcgctactgggaggatctcctcctg
gctatgatcggtgaccagtttgcagaggctagtgatgaggtttgtggtgcggtgctcagt
gtgcggagcggggaggatgttctgaatgtgtggacccgcatcgatggcgggcggaacatc
aagatcagagagacaatcaaacgtctgctgaacttcccggccgacaccaatatcgtctgg
aagagtcatgacgacagtatcgcccaacgttcggccatcgaccaggctcgccaggagaag
gccgccggaaacgccggtcatcaccaccatcaccatcaccatcaccaccaccacaacaac
aacaacaaccacaatcacaaccagcaaaaccagctgggcgatcgacgaagagttacggcg
aatgacgagggggataaaggaaaaggcacgacatcttga

DBGET integrated database retrieval system