KEGG   Aspergillus niger: ANI_1_674084Help
Entry
ANI_1_674084      CDS       T01030                                 

Gene name
An09g05380
Definition
translation initiation factor eIF4E3
Orthology
K03259  
translation initiation factor 4E
Organism
ang  Aspergillus niger
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ANI_1_674084 (An09g05380)
Translation factors [BR:ang03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ANI_1_674084 (An09g05380)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 352 aa AA seqDB search
MDNANLWTRRSNTSKLSLSMTGTDGARVELPRATKRFGPDSSHGGRSNPFNALSPLSGGV
SSPSTNASSAFGLGSGAFASFGTPKTPGAPSDLKTPGEKRENPVDQVSAAEAGKPKGAAL
TLKEHPLKSTWIIWYRPPTPKYSDYEKSTAPLASISSVESFWSIYSHLKRPSLLPTVSDY
HIFKKGIRPVWEDEANKRGGKWVVRLKKGVADRYWEDLLLAMIGDQFAEASDEVCGAVLS
VRSGEDVLNVWTRIDGGRNIKIRETIKRLLNFPADTNIVWKSHDDSIAQRSAIDQARQEK
AAGNAGHHHHHHHHHHHHNNNNNHNHNQQNQLGDRRRVTANDEGDKGKGTTS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggataacgcaaacctctggactcgccgatccaacacctccaagttgtctctgtctatg
acggggacggacggcgctcgagttgaacttccccgcgccaccaagcgtttcggccccgac
agctcccacggcggccggtccaaccctttcaacgccctctcccccctctccggcggcgtg
tcctctccgtctacaaacgcctcctctgcattcggcctgggctccggtgcctttgcgtcg
tttggaacccccaaaacccccggtgcaccttccgacctgaaaactcccggcgagaagcgt
gaaaaccctgtcgaccaggtttccgctgctgaggccggcaaacctaagggcgctgccttg
acgctcaaggagcacccgctcaagtccacttggattatctggtaccggcctcccacacct
aaatactccgattacgaaaagtctaccgctccgcttgcatccatatcatcagtagagagt
ttctggtcgatctattcgcacctaaagaggccctctctgctccccacagtctccgactac
catatcttcaaaaagggcatccgtccggtatgggaggacgaggccaataagagaggtgga
aaatgggtggtgaggctgaagaagggggttgcggatcgctactgggaggatctcctcctg
gctatgatcggtgaccagtttgcagaggctagtgatgaggtttgtggtgcggtgctcagt
gtgcggagcggggaggatgttctgaatgtgtggacccgcatcgatggcgggcggaacatc
aagatcagagagacaatcaaacgtctgctgaacttcccggccgacaccaatatcgtctgg
aagagtcatgacgacagtatcgcccaacgttcggccatcgaccaggctcgccaggagaag
gccgccggaaacgccggtcatcaccaccatcaccatcaccatcaccaccaccacaacaac
aacaacaaccacaatcacaaccagcaaaaccagctgggcgatcgacgaagagttacggcg
aatgacgagggggataaaggaaaaggcacgacatcttga

DBGET integrated database retrieval system