KEGG   Aspergillus niger: ANI_1_682124Help
Entry
ANI_1_682124      CDS       T01030                                 

Gene name
An14g04920
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ang  Aspergillus niger
Pathway
ang00010  Glycolysis / Gluconeogenesis
ang00051  Fructose and mannose metabolism
ang00562  Inositol phosphate metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01200  Carbon metabolism
ang01230  Biosynthesis of amino acids
Module
ang_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ang_M00002  Glycolysis, core module involving three-carbon compounds
ang_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANI_1_682124 (An14g04920)
   00051 Fructose and mannose metabolism
    ANI_1_682124 (An14g04920)
   00562 Inositol phosphate metabolism
    ANI_1_682124 (An14g04920)
Enzymes [BR:ang01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ANI_1_682124 (An14g04920)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ANI_1_682124 (An14g04920)
  Exosomal proteins of bladder cancer cells
   ANI_1_682124 (An14g04920)
  Exosomal proteins of melanoma cells
   ANI_1_682124 (An14g04920)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 4987350
NCBI-ProteinID: XP_001401115
UniProt: A2R3N5
AA seq 249 aa AA seqDB search
MPRQFFVGGNFKMNGTADSITSIIKNLNAAKLDESAEVVVSPPTLYLLPARQAAGEKIGV
AAQNVFDKPNGAFTGEISVEQLRDVKIDWTIIGHSERRVILKESDEFIARKVKAAIDGGL
SVIFCIGETLEEREANKTIDVVTKQLNAVAKELTKEQWAKVVIAYEPVWAIGTGKVATTA
QAQEVHAAIRKWLVDAISAEAADNTRIIYGGSVSEKNCRDLAKEADVDGFLVGGASLKPA
FVDIINARL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcaattcttcgtgggtggtaacttcaagatgaacggtactgcggacagcatt
acctccatcatcaagaacctcaatgccgccaagttggacgagtccgccgaggtggttgtc
tctccccccaccctctacctgctccccgcccgccaggccgccggcgagaagatcggcgtc
gccgcccagaacgtcttcgacaagcccaatggtgctttcaccggtgagatcagtgttgag
cagctccgtgatgtcaagatcgactggaccatcattggtcacagcgagcgccgtgtcatc
ctgaaggagagcgacgagttcattgcccgcaaggtcaaggccgccattgacggtggcctc
agcgttatcttctgcattggtgagactcttgaggagcgtgaggccaacaagaccatcgac
gttgtcaccaagcagctcaacgctgttgccaaggagctcaccaaggagcagtgggctaag
gttgttatcgcctacgagcccgtctgggctatcggtaccggcaaggtcgccacgaccgcc
caggcccaggaggtccacgctgctatccgcaagtggctcgtcgatgccatctctgccgag
gctgccgacaacacccgcatcatctacggtggttccgtcagcgagaagaactgccgtgac
ctggccaaggaggctgatgtcgacggtttcctggttggcggtgccagcttgaagcctgcc
ttcgttgacatcatcaacgctcgtctgtaa

DBGET integrated database retrieval system