KEGG   Aspergillus niger: ANI_1_688184Help
Entry
ANI_1_688184      CDS       T01030                                 

Gene name
An04g03750
Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ang  Aspergillus niger
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANI_1_688184 (An04g03750)
Enzymes [BR:ang01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ANI_1_688184 (An04g03750)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 320 aa AA seqDB search
MDRSNKPAAIGVGASLPQPTISLRDNTVEATLPTGESVTVHLYGATVTSWKLANGKEQLF
VSEKAHLDGSKPIRGGIPVVFPVFGPPPSNHATSALPQHGFARNSNWEFLGKSSSEAFGR
DRKEGEDAVKLDFGLSHPMLSEEFQKAWPYQFGLVYSVTLTKGSLETSLQVQNQGEQNFD
FQVLMHTYLSVEDISNIRVKNLQQKEYLDKTQGGAAITETSEAVEINKETDRVYKALDPK
VPIIVSTASDDQPLFSITREALTDVVVWNPWIEKAKGMADFGPDEAYKNMLCVEAGSVAG
WQTLEAGESWEGGQTIRPRL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttccaacaagcctgccgccatcggcgtcggtgcctctcttccccaacccacc
atctccctccgcgacaacaccgttgaagctaccctccccaccggcgagtccgtcactgtc
cacctctacggagccaccgtcacctcctggaagctcgccaatggcaaggaacagctcttc
gtgagcgagaaggctcatctagatggctccaagcctatccggggtggtattcccgtcgta
ttcccggtcttcggtcctcctccctccaatcacgccacctctgcactccctcaacacggc
tttgcccggaactcgaactgggaattcctcggcaaatcctcgtccgaagcgttcggccgc
gaccggaaagaaggcgaagacgctgtgaagttggacttcggattgtcgcatcctatgctg
agcgaggaattccagaaggcctggccgtatcagtttggattggtgtatagcgtaactttg
acaaaggggagcctggagacttctctgcaggtgcagaaccagggcgagcagaatttcgat
ttccaggtgttgatgcacacgtatttgagtgttgaggacatctccaacatccgcgtcaag
aacctccagcaaaaggaatacttggacaagacacagggcggtgcagctatcacggagact
tcggaggcagtggagatcaacaaggaaacggaccgtgtgtacaaggcattggatccgaag
gtgccgattatcgtgtccacggcgtcggatgatcagcctctgttctcgatcacaagggag
gccttgacggatgtggtggtgtggaacccctggatcgagaaggccaagggtatggcggac
tttggtcccgatgaggcatacaagaacatgctttgtgtcgaggccggttctgttgctgga
tggcagaccctggaggcaggcgaatcttgggaaggtggacagactatccggccccggctg
tag

DBGET integrated database retrieval system