KEGG   Aspergillus niger: ANI_1_688184Help
Entry
ANI_1_688184      CDS       T01030                                 

Gene name
An04g03750
Definition
(RefSeq) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ang  Aspergillus niger
Pathway
ang00010  Glycolysis / Gluconeogenesis
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANI_1_688184 (An04g03750)
Enzymes [BR:ang01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ANI_1_688184 (An04g03750)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim Glyco_hydro_65C
Motif
Other DBs
NCBI-GeneID: 4990781
NCBI-ProteinID: XP_001401742
UniProt: A2QIJ6
AA seq 320 aa AA seqDB search
MDRSNKPAAIGVGASLPQPTISLRDNTVEATLPTGESVTVHLYGATVTSWKLANGKEQLF
VSEKAHLDGSKPIRGGIPVVFPVFGPPPSNHATSALPQHGFARNSNWEFLGKSSSEAFGR
DRKEGEDAVKLDFGLSHPMLSEEFQKAWPYQFGLVYSVTLTKGSLETSLQVQNQGEQNFD
FQVLMHTYLSVEDISNIRVKNLQQKEYLDKTQGGAAITETSEAVEINKETDRVYKALDPK
VPIIVSTASDDQPLFSITREALTDVVVWNPWIEKAKGMADFGPDEAYKNMLCVEAGSVAG
WQTLEAGESWEGGQTIRPRL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttccaacaagcctgccgccatcggcgtcggtgcctctcttccccaacccacc
atctccctccgcgacaacaccgttgaagctaccctccccaccggcgagtccgtcactgtc
cacctctacggagccaccgtcacctcctggaagctcgccaatggcaaggaacagctcttc
gtgagcgagaaggctcatctagatggctccaagcctatccggggtggtattcccgtcgta
ttcccggtcttcggtcctcctccctccaatcacgccacctctgcactccctcaacacggc
tttgcccggaactcgaactgggaattcctcggcaaatcctcgtccgaagcgttcggccgc
gaccggaaagaaggcgaagacgctgtgaagttggacttcggattgtcgcatcctatgctg
agcgaggaattccagaaggcctggccgtatcagtttggattggtgtatagcgtaactttg
acaaaggggagcctggagacttctctgcaggtgcagaaccagggcgagcagaatttcgat
ttccaggtgttgatgcacacgtatttgagtgttgaggacatctccaacatccgcgtcaag
aacctccagcaaaaggaatacttggacaagacacagggcggtgcagctatcacggagact
tcggaggcagtggagatcaacaaggaaacggaccgtgtgtacaaggcattggatccgaag
gtgccgattatcgtgtccacggcgtcggatgatcagcctctgttctcgatcacaagggag
gccttgacggatgtggtggtgtggaacccctggatcgagaaggccaagggtatggcggac
tttggtcccgatgaggcatacaagaacatgctttgtgtcgaggccggttctgttgctgga
tggcagaccctggaggcaggcgaatcttgggaaggtggacagactatccggccccggctg
tag

DBGET integrated database retrieval system