KEGG   Aspergillus niger: ANI_1_736184Help
Entry
ANI_1_736184      CDS       T01030                                 

Gene name
An04g04060
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ANI_1_736184 (An04g04060)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MASAARTASRAFLRSTPATSSFRPAARSARFALPSQGFRAASRRGYTSEAGEAKSSNSLL
WAGIAAAGGVGAYFYLKGGDASVTSKDFVPTKEDYQKVYDAVAHRLANETDYDDGSYGPV
LVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKHARDFLEPIKAQFPWITYS
DLWTLAGACAIQELGGPAIPWRPGREDKDVAACTPDGRLPDATKEQSHIRDIFYRMGFND
QEIVALVGAHSLGRAHTDRSGFDGPWDFSPTVFTNEFFRLLVEEKWQQRKWNGPKQFTDK
TTGTLMMMPADLALTKDKAFRKYVELYAKDSDLFFKDFSNVFVKLLELGVPFKTEDRYVF
KTSE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgctgctagaacggcttcccgggccttccttcgctcgacccccgctacctct
tccttcagacctgctgctcgcagtgctcgctttgccctcccctctcagggcttccgtgct
gcctctcgccgcggctatacctctgaggctggtgaggccaagtcctctaacagcctcctg
tgggctggtattgccgccgctggtggtgttggcgcctacttctacctgaagggtggtgat
gcctccgtcacctccaaggactttgtccccaccaaggaggactaccagaaggtgtacgat
gccgttgctcaccgtctcgccaacgagaccgactatgacgatggcagctatggacccgtt
cttgtccgtctggcatggcacgcaagcggtacctacgacaaggagactggcactggtgga
agcaacggtgccaccatgagatttgcccctgagtccgaccacggcgccaacgctggtctc
aagcacgccagagacttcttggagcccatcaaggcccagttcccctggatcacctactcc
gacctgtggaccctggctggtgcctgcgccatccaggagcttggtggccctgccatccct
tggagacctggccgtgaggacaaggacgttgctgcttgcacccctgacggacgtcttccc
gacgccaccaaggagcagtcgcacatccgtgacatcttctaccgcatgggattcaacgac
caggagatcgttgctctggttggagctcactcccttggtcgcgcccacactgaccgctcc
ggcttcgacggtccctgggacttcagccctaccgtcttcaccaacgagttcttccgtctg
ttggtggaggagaagtggcagcagcgcaagtggaacggccctaagcagttcactgacaag
accactggtaccctgatgatgatgcccgctgaccttgccctgaccaaggacaaggccttc
cgcaagtacgtcgagctctatgctaaggacagcgacctcttcttcaaggacttctccaat
gtgttcgtcaagctcctcgaacttggtgtccccttcaagactgaggaccgctatgtcttc
aagacctctgagtag

DBGET integrated database retrieval system