KEGG   Aspergillus niger: ANI_1_74Help
Entry
ANI_1_74          CDS       T01030                                 

Gene name
An08g00010
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ang  Aspergillus niger
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ANI_1_74 (An08g00010)
Enzymes [BR:ang01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ANI_1_74 (An08g00010)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANI_1_74 (An08g00010)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MSFSNLVSDLAFRDAQDDRSSQISHARSQATARSYTSTAATSVSISGDISSQLHSGYSHP
LSRSWQAEKQLTKEMLIYPLFITDNPDEETPIPSLPNQYRRGLNRLVPFLRPLVQKGLRS
VILFGVPLHPSAKDALGTAADDPTGPVVQAIRLLRSRFPQLYIVTDVCLCEYTSHGHCGI
LREDGTLDNAQSVDRISDVALAYAAAGAHCVAPSDMNDGRVRAIKLKLIEAGIAHRVLLM
SYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGRGLARRAIQRDIGEGADIIMVKPA
SSYLDIIRDAKELAKDMPVAAYQVSGEYAMIHAGAKAGVFDLKSMAFESTEGILRAGAGI
IVSYFVPDFLDWLS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttcaaaccttgtttctgaccttgcgttcagagacgctcaggatgaccgaagt
tctcaaatatcccatgcacggtctcaagctaccgctcgatcatataccagcacggctgcg
accagcgttagcatatctggtgatatctctagccagcttcattctggctatagtcatcca
ctgagtagatcatggcaagccgagaagcagttgaccaaggagatgctcatatatcccctt
ttcattaccgataaccctgatgaggagacgcctattccatcccttccaaatcagtatcgc
cgaggactgaatcggttggtccccttcttaagaccattagtacagaaaggcctgcgttcc
gtgattctgttcggtgtccctttgcatccatctgcaaaggatgcgctgggaaccgctgca
gatgacccgaccggtccagtagttcaggccatccgccttcttcgttcgcgctttcctcaa
ctttatatcgtgacggatgtttgtctttgtgaatacacctcacatggtcattgcgggata
ctacgtgaggatgggacgctcgataacgcacagtccgttgatagaatctcagatgtagcc
ctcgcctatgctgctgccggtgctcactgcgtggctccgtcagatatgaatgacggcaga
gtccgcgccataaagctgaagcttattgaagctggcatagctcatcgtgtcctcctaatg
tcctacagtgcaaaattcagtggatgtctatatggtcccttccgagatgccgcaggctct
tgcccatccttcggagaccgcaggtgttaccaattacccccaggtggccgggggcttgct
cggcgagcgatacagcgcgatattggtgagggcgcagacatcataatggtgaagcccgct
agtagctatttggatatcatacgggacgccaaagagctcgccaaagacatgccagttgcc
gcttaccaagttagcggagagtatgccatgatacatgcaggggctaaggctggcgttttc
gatttgaaatcaatggctttcgagagcacagagggtatactacgggcaggagctggtatt
attgtgagctactttgtgcccgactttctggattggctttcttaa

DBGET integrated database retrieval system