KEGG   Aspergillus niger: ANI_1_788014Help
Entry
ANI_1_788014      CDS       T01030                                 

Gene name
An01g06120
Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ang  Aspergillus niger
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ang00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 2042 aa AA seqDB search
MSSPQQVYLLPLKDDGSPDVPGGYIYLPAPTNPPYLLRFVIEGSSSICREGALWVNIPEK
GESFNRSAFRSFSLSPDFNKNIQIDVPITSAGSFAFYVTFSPLPEFSVLSTPTPEPTRTP
THYIDVSPKLTLRGQDLPLNALSIYSVISKFMGQYPKEWEKHLNGISQRNYNMVHFTPLM
KRGASNSPYSIFDQLQFDDAVFPNGEDDVARLISKMENEYGLLSLTDVVWNHTAHNSKWL
EEHPEAGYSVETAPWLEAALELDTALLKFGQDLQNLGLPTEFQTVDELMKVMNVMRDKVI
AGIRLWEFYAIDVKSDTHKILDKWKTSKDIDLTDTNWAQLNLQDYKNWTLKQQATFIRDH
AIPTSKQVLGRFSRAVDLQFGAAILTALFGPHNPSTSDTSIVEESLSKILDEVNLPFYEE
YDGDVSEIMNQVFNRIKYLRIDDHGPKLGAVTAQSPLIETYFTRLPLNDVTKKHKKEALA
LVNNGWIWNADALRDNAGPDSRAYLRREVIVWGDCVKLRYGSCRDDNPFLWDFMTDYTRL
MAKYFSGFRIDNCHSTPLVVAEYLLDEARKVRPNLTVFAELFTGSEEADYIFVKRLGINA
LIREAMQAWSTGELSRLVHRHGGRPIGSFDLDLPSSGSSHAIASSGLDSGKEKVVHIRPT
PVQALFMDCTHDNEMPAQKRTAKDTLPNGALVAMCASAIGSVIGYDEVYPRLVDLVHEHR
LYFSEFSEAPETGLNSLEGGIGGIKKLLNELHTKMGIEGYDETHIHHDGEYITVHRVHPR
TRKGVFLIAHTAFPGQDSRSVLAPTHLVGTQVKHIGTWLLEVDTSQTTKERIQADKSYLR
GLPSQVKTFEGTKIEESGKDTIISVLNSFVAGSIALFETSMPSVEHASGLDNYITEGVDH
AFSDLSLVDLNFALYRCEAEERDSSKGQDGAYDIPGHGPLVYAGLQGWWSVLENIIKYNE
LGHPLCDHLRNGQWALDYIVARLEKLSHKEEHPALGRPAAWLQEKFQAVRQLPSFLLPRY
FAIIVQVAYNAAWKRGIQLLGPHIQKGQEFIHQLGMVSVQQTGYVNSASLWPTKKVPSLA
AGLPHFAVDWARCWGRDVFISLRGLLLCTGRFEDAKEHITAFASVLKHGMIPNLLSSGKL
PRYNSRDSVWFFLQSIQDYTEMAPDGLEILDHKVPRRFLPYDDVWFPFDDPRAYSQQSTI
SEIIQEVFQRHAQGLSFREYNAGPDLDMQMTQDGFQIDVKVDWETGLIFGGSQYNCGTWQ
DKMGESAKAGNKGVPGTPRDGAAIEITGLVYSALTWVAKLHERGIYKHDGVDIGGGKSIS
FEDWASRIRANFERCYYVPLQPKDDGQYDIDANIINRRGIYKDLYRSGKPYEDYQLRSNF
PIAMTVAPDLFTASKALAALALADEVLVGPVGMATLDPSDLNYRPNYNNSEDSTDFATAK
GRNYHQGPEWVWQRGYFLRAFLHFDLARRTTPAERTETYQQITRRLEGCKRALRESPWKG
LTELTNKNGAYCADSSPTQAWSAGCLLDLYYDASRHSQMRIWYGPFKLRYKNIDAIDYYE
EKLRRLDEKIQVARQKEYPPTEVAFVTMESIAASQMVVQAILDPHPMQLLARLAPAPADV
VWKNTYLPRSRRMMQSWFITVVIGFLTVFWSVLLIPVAYLLEYETLHKVFPQLADALARN
PLAKSLVQTGLPTLVLSLLTVAVPYLYNWLSNQQGMMSRGDIELSVISKTFFFSFFNLFL
VFTVFGTATTFYGFWENLRDAFKDATTIAFALAKTLENFAPFYINFLCLQGIGLFPFRLL
EFGSVAMYPINFLAAKTPRDYAELSTPPTFSYGYSIPQTVLSLIICVVYSVFPSSWLICL
FGLIYFTIGKFIYKYQLLYAMDHQQHSTGRAWPMICSRILMGLMVFQLAMIGVLALRRAI
TRSLLIVPLLMATVWFSYFFARTYEPLMKFIALKSIDRERPGGGDISPSPSSTFSPPSGL
DRDSFPIRIGGQELGLRLRKYVNPSLILPLHDAWLPGRTMVPELQGELEHRNPGNNAADE
SV
NT seq 6129 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctccacagcaggtttatctgctgcctctgaaggatgatggatcgcccgatgtt
cctggaggatatatctacctccctgctcccactaacccgccatacttactccggtttgtc
attgaaggcagcagctcaatctgcagagagggtgctttatgggtgaacatccctgagaag
ggcgagtctttcaatcggtctgcttttcgaagcttcagcctatccccggacttcaacaag
aacattcagatcgatgtccccatcacctctgctggttctttcgccttctatgtgaccttc
tccccgcttcctgagttctccgttctatcaacacccaccccagagccaacaaggactcca
acccattatatcgatgtctcacccaagttgactcttcgcggtcaagatctcccgctcaat
gccctctctatatactctgtgatctctaagttcatgggccagtatcccaaggagtgggag
aaacacctcaacggtataagccagcgtaattacaatatggttcatttcacgcccttgatg
aaacgcggagcttccaattcaccttatagcatctttgatcaactacaatttgatgacgcc
gtgttccccaatggtgaagacgatgttgcgcgtctgatatctaagatggagaatgaatat
ggacttctgtcgcttacggatgttgtatggaaccacaccgcccataacagcaaatggttg
gaggagcacccagaagccggctacagtgtcgaaactgccccatggcttgaggcagcactg
gagctggacactgcgctgctgaaattcggacaggatctccaaaaccttgggctgccgacc
gagtttcaaactgtggacgaattgatgaaagtcatgaatgttatgcgggacaaggtcatc
gctggaatacgactatgggaattctacgccattgatgtgaagagtgacacacataaaata
ctcgacaaatggaaaacatccaaagacatagatctaacagacacgaactgggcgcaactc
aatcttcaagactacaaaaactggactttgaagcaacaagcaaccttcatccgagaccat
gctatacctacttcgaaacaggtcttgggccggttcagcagagctgttgatttgcagttt
ggggcagccatactaacagcacttttcggtccacataatccttcgacgtccgatactagt
atagtcgaggaaagtctctctaaaatactcgacgaggtcaatcttccattctacgaggag
tatgatggcgatgtctcggaaattatgaatcaagtcttcaaccggataaaatatttacgg
attgatgaccatggacccaagctcggcgccgtcacggcacaaagcccattgatcgaaacg
tacttcacaaggctgcctctgaacgatgttaccaagaagcacaagaaagaggcgctggcg
ctggtcaacaatggctggatatggaacgctgatgctctgcgggacaatgcggggcccgac
tccagggcttatctgcgacgtgaagtaatcgtctggggtgattgcgtgaagctgagatat
ggcagctgtcgtgacgataatcctttcctctgggatttcatgacagactatactcggctc
atggccaaatatttctcagggttccgcatcgacaattgccattcgacaccattggtggtt
gccgagtatctgctagacgaggcacgcaaagttcgacccaatctgactgttttcgcggaa
ctatttactggctcggaggaagctgattatatatttgtcaaacgtctcggcataaatgcg
ctcattcgtgaggccatgcaagcttggagtacaggggaactaagtcgtcttgttcatcgt
catggcggacgcccgattggtagtttcgatcttgacttgccctcttcaggcagtagtcat
gcaatagcttcttctggtcttgactccggcaaagaaaaagttgttcatattcggcctaca
ccagttcaggccttattcatggattgcactcatgacaacgagatgcccgcgcagaagaga
accgccaaagatactctgccaaatggggctctggtagctatgtgtgcctcagccattggc
agcgtcatcggctatgatgaagtatatcctcggcttgtcgatctcgtccatgagcatcgg
ctatacttctctgaattctcagaggcccccgagactggtctgaactctctcgaagggggg
attggaggcatcaaaaagctactcaatgagcttcataccaagatgggtattgaaggttat
gacgagacgcacattcatcatgacggtgagtatatcactgtgcacagggtgcatcccaga
acacggaaaggtgttttcttgattgcacatacggcgtttcctggtcaagatagcagatct
gtacttgcgcctacacatcttgtcggtactcaggtcaagcatatcgggacgtggctcttg
gaagtggatacaagccaaactaccaaggagcggatacaagcagacaagtcctacctacgg
ggcctgccaagccaagtcaaaacgtttgaaggtaccaagatcgaggagtctggcaaagat
accatcatatccgttttgaattcttttgttgccgggtctattgcgttgtttgaaacatcc
atgccgagtgttgaacatgcaagtggactggacaattacatcaccgaaggcgtggatcat
gcattctcggatcttagcttagtcgatctaaacttcgcgctttaccgctgcgaagctgaa
gagagagattcgagtaagggccaggacggggcttacgacatccccggccatggccccttg
gtctatgccggtctacaggggtggtggagcgtgcttgagaacatcatcaaatacaatgaa
ctaggccacccactgtgtgatcacctgcgaaacggacagtgggctctggactatattgtg
gctcgcctggagaagttgagccacaaggaagagcaccctgcccttggcaggccggctgca
tggctgcaggagaagttccaggccgttcgtcagctgccaagctttcttttaccccggtac
tttgcgataatcgttcaggttgcctacaatgccgcctggaagcgagggattcaactgctg
ggaccgcatatacaaaaagggcaagaattcattcatcagttaggtatggtgagcgtccaa
caaactggatatgtgaattcggcgtctttgtggcccacaaagaaggtacccagtcttgca
gctggccttccgcattttgcggtagactgggcgagatgctggggccgcgacgtgttcatc
tcactcagaggcctccttctgtgcacaggtcgctttgaggatgccaaagagcacataacg
gcatttgcaagtgtactgaaacatggcatgatcccgaatcttctgagcagtgggaagctc
ccgcgctacaattctcgggattctgtatggttcttcctgcaatccatccaggattacact
gaaatggcaccagatggactggaaattctcgatcataaggttcccagacgttttctacca
tacgacgatgtatggttcccgtttgatgatccgagggcctactcgcaacagtcaacgata
tccgaaataattcaggaggtcttccagcgacacgcacaaggactctccttcagagaatac
aacgccgggcctgaccttgatatgcagatgacacaggatggtttccagattgatgtcaaa
gtcgactgggaaacagggctgatattcggtggtagccaatacaattgcgggacatggcag
gacaagatgggtgagagcgcgaaagcgggtaacaaaggcgtacctgggacaccacgagac
ggggcagcaatcgagataaccgggctagtgtacagcgccttgacttgggttgctaaattg
cacgagcgtggcatttacaaacatgatggagttgacattggaggtgggaaatccatctct
ttcgaagattgggcgtcaagaattcgggccaacttcgaacgctgttactatgttcctcta
cagccaaaggacgatggccaatacgacatcgacgcaaacatcatcaatagaagggggatt
tacaaggacctgtacaggtctggtaaaccatacgaggactaccagcttcgttccaacttc
ccgatagccatgaccgtcgctccagacctgtttactgcctccaaagcacttgcagctctg
gctcttgccgacgaggtcctggtcgggccagtgggaatggccactctggatccctccgac
ctcaattaccgccctaactacaataattccgaggactcgaccgattttgcaaccgccaaa
gggagaaattaccaccaaggtcctgagtgggtttggcagcgtgggtacttcctccgcgcc
tttttgcacttcgaccttgctcgcaggacgacaccggcggaacggacggagacataccaa
cagattactcgacgcttggagggttgcaagcgggctttgagggaaagtccatggaagggc
cttaccgaactaacgaataagaatggtgcctactgtgcagattcctcacccacccaagca
tggtcagctggatgtctgcttgatttgtattatgatgcatcaagacattcacagatgcgc
atttggtatgggcctttcaagttacgctacaagaacatcgatgcgatcgattactatgag
gagaagctgcgtcgtctcgacgagaaaattcaggttgctcgtcaaaaggaatatcctcct
accgaggttgccttcgtaacgatggagtcgatcgccgcgtctcagatggttgtacaggcc
atccttgatcctcaccccatgcaactactcgctagactggctccagctccagctgatgtc
gtgtggaaaaacacatatctcccgcgctcgaggcggatgatgcaatcctggttcatcact
gtggtcattggcttcctgactgtattctggtcggtgcttttgattcccgttgcctatctg
cttgagtacgagactctccacaaggtgttccctcaattggccgacgcccttgctcggaac
ccacttgccaagtcccttgtgcagactggtctgccgaccttggttctctcgctgttgact
gtcgctgtgccttatctctataactggctctcgaaccaacaaggcatgatgtctcggggt
gacattgagctgtcggtaatttcgaagaccttcttcttctctttcttcaacctcttcctc
gtctttacggtattcggaaccgcgacgacattctacgggttctgggagaatctccgagat
gccttcaaagatgcaacgaccatagcctttgcattggccaaaactctggaaaactttgct
cctttttatatcaacttcctatgtcttcaaggaataggattgttcccgttccgactcctt
gagtttggaagtgttgccatgtatcccatcaacttcctggccgctaagacgcctcgagac
tatgctgagctatccacaccccctacattcagctacgggtattccattccgcagacggtc
ctaagtcttatcatctgtgtggtatacagcgtgttccctagctcatggttgatatgcctg
tttggattgatttacttcacaatcggcaagttcatctacaagtatcagcttctgtacgcg
atggatcatcagcagcattcgacgggacgagcgtggccgatgatctgcagccgaatcttg
atgggcttgatggttttccagctggcgatgatcggcgtgctagccttacgccgggctatc
acccgctctctgctcatcgtccctctccttatggcaaccgtatggttcagctacttcttt
gcccggacctatgagcctcttatgaaattcatcgctttgaagagcattgaccgcgagcgg
cctggcgggggggatatctctccgtccccgtcgtcgaccttctctcctccgtccggcctc
gaccgcgattcttttccgatccggattggtggacaagaactcggactacggctgaggaag
tatgtcaacccaagcctgatcctgcctcttcatgatgcatggcttccgggacgcacgatg
gttccagagcttcagggagaactggagcatcgcaatcctggaaacaatgcggccgatgag
tccgtctga

DBGET integrated database retrieval system