KEGG   Aspergillus niger: ANI_1_812024Help
Entry
ANI_1_812024      CDS       T01030                                 

Gene name
An02g05890
Definition
disulfide isomerase
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ang  Aspergillus niger
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ANI_1_812024 (An02g05890)
Enzymes [BR:ang01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ANI_1_812024 (An02g05890)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 731 aa AA seqDB search
MRVSLLAWSLLSLLSIPALAAPSDNVSPSHHLVKRGDSDVKSEGQSTTFNGIEVPPMKAL
TPDNFDDTIKDGYWFVKQYSPSCPHCQKIAPTWQTLYEFYYTSDPLSSPSSKSSNTDSLN
SFHGFYNFHFAEMNCLAHGDLCRKLDVKYFPTFALYHNGELVEQYTGKKSMEGISEFVEE
KLEQIKPGSRPAQGLHLPKPGDKGVDTQAQPEAPVAKDKDREAGTKAGEKHNEQAAQLAE
DETPADKASIKSKTKPKPAPANPQGISVPLTAESFQKLVTTTQDPWFIKFYAPWCHHCQA
LAPNWREMAKEMQGVLNVGEVNCDAESRLCKDARVSGFPTMYFFRGGERVEYTGLRGLGD
LVSYAKKAVDVGSGVQDVDATTFKELEEKEDVIFLYFYDHATTSEDFEALERLTLSLVGH
ARLVKTNSAALAERFKISTWPRLLVSRDGRPSYYNALAPKDMRDFRQILNWMRTVWLPIV
PELTASNAREIMDGKYVVLGILSRKHSDEFLQSKRELKNAALEWMDKQTQLFQLERAELR
DAKQLRIEEAEDRNDQRALRAAKNMRITIREDDKKQVGFAWIDGDFWERWLRTTYGIDVE
NGERVIINDQDNRRYWDTSSSGASIMASRTSILETIPLVIANPPKLTPKSTVGTFESVFF
FTRTFISGHPIIFFILLTLSVAGATIVARGRSLRRGARGGILGVTGNTGGGFFNLDGKEG
LLNGGSTGKVD
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagggtctctttgctggcgtggtctctactctctcttctctcgattcccgccttagcc
gccccctccgataatgtctctcccagccatcatctcgtaaagagaggcgactccgacgtg
aagtcggagggccagtcgactacctttaatggtatcgaggtcccgcctatgaaggctctg
actcccgacaatttcgatgacacgattaaggatggctactggttcgtcaagcagtactcc
ccgtcctgcccacactgccagaagattgcacctacatggcaaacgctttatgaattctat
tacacctccgatcctttgtcctcgccgtcctccaagtcgtccaacaccgattcgttgaac
tccttccatggcttttacaacttccatttcgccgagatgaactgtctcgcgcatggcgat
ctttgccgcaaactcgacgtcaaatacttccccacctttgcgctgtaccacaacggtgaa
ctggttgaacagtacactggaaagaagagtatggaggggattagcgagttcgttgaggag
aagctggaacagatcaagcctggttcgcggcctgcccagggtctccacctccccaagcct
ggcgacaagggagtggatactcaggctcaaccggaggcgcccgtcgccaaagataaagac
cgtgaggcgggcaccaaggccggagaaaagcacaacgagcaggctgcacagctggccgag
gatgagacacccgcagacaaggcgtcgatcaagtctaagactaagccgaagccggcccct
gctaacccccagggtatttctgtccctctcaccgcggaaagtttccagaagctggtcacg
actactcaggatccttggttcatcaagttttacgcaccatggtgccaccactgtcaagca
ttggctcccaactggagggaaatggcaaaggagatgcagggtgttctcaacgtgggtgaa
gtgaactgcgacgcggaatcccgactctgcaaagatgcccgtgtcagcggcttcccgacg
atgtatttcttccgcggcggtgagagggtcgaatataccggcctccgtggcctcggagat
ttggtcagttatgccaagaaggctgttgatgttggatccggtgtacaggatgtcgatgcc
accaccttcaaagagttggaggagaaagaggatgttatcttcctgtacttctatgaccac
gcaaccacctcggaagatttcgaagctctcgagcgcctgacccttagtttggtcggtcat
gcccggcttgtcaagacgaacagcgctgctcttgcggaacggttcaagatctcgacctgg
cctcgtctccttgtgtcccgcgatggccgccccagctactacaatgcgcttgcgcctaag
gatatgcgggacttccgccagattctcaattggatgcgcactgtgtggctgcccattgtt
cctgaacttaccgcctcaaacgcgcgggagatcatggatggcaagtatgtggtcctcggc
atcctgagccggaagcactcggatgagttccttcaatcgaagcgagagctcaagaatgcc
gcccttgagtggatggataagcagacgcagttgttccagttggagcgtgctgagctgcgt
gacgctaagcaactgcggatcgaggaagctgaagaccgtaacgatcaacgggccttgcgg
gcagccaagaacatgcgcattaccatccgcgaggatgacaagaaacaagtcggtttcgct
tggattgatggcgatttctgggaaaggtggctcagaaccacatatggcatcgatgtcgag
aacggcgaacgcgtgattatcaacgatcaggataaccggcgctactgggatacgtcttcc
agcggagcttcgatcatggcttcccgaacctccatccttgagaccatccccttggtcatt
gccaacccaccgaaacttacacccaagtccaccgtcggtacctttgagtctgtcttcttc
ttcactcggactttcatcagtggtcacccgatcatcttcttcatcctcctgacgctttcg
gtggctggtgctacaatcgtagctcggggaagaagtcttagacgcggggctcgtggcgga
attctcggggttactggtaacaccggcggtggtttcttcaaccttgatggaaaggaaggt
cttctgaacggtggatcgaccggcaaggttgattga

DBGET integrated database retrieval system