KEGG   Aspergillus niger: ANI_1_826024Help
Entry
ANI_1_826024      CDS       T01030                                 

Gene name
An02g06030
Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ang  Aspergillus niger
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ANI_1_826024 (An02g06030)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    ANI_1_826024 (An02g06030)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     ANI_1_826024 (An02g06030)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 302 aa AA seqDB search
MSSPVTAARYGKDNVRVYKVHRDEKTGVQTVVEMTVCVLLEGDIDTSYTKADNSVIVATD
SIKNTIYITAKQNPVTPPELFGSILGSHFITKYNHIHAAHVNIITHRWTRMTIDGKPHPH
SFLRDGEETRNVQVDVVEGKGVDITSSLAKLTVLKSTNSQFWGFLRDEYTTLPETWDRIL
STDVDASWQWRRFSGLDEVRATVPHFDATWAAAREITLKTFAEDNSASVQNTMYKMAEQI
LARQSLLETVEYSLPNKHYFEVDLSWHKGLKNTGKDAEVYAPQTNPNGLIKCTVGRNTKA
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccccagttactgcggcccgctacggcaaggacaatgtccgagtatacaaggtc
caccgcgacgagaagaccggcgtccagacagtcgtggagatgaccgtctgcgtccttttg
gagggtgacatcgacacctcctacaccaaagccgataacagcgtcattgtcgcaaccgac
tccatcaaaaacaccatctacatcaccgccaagcaaaatcccgtcactccccccgagctc
ttcggctccattcttggaagccacttcatcaccaagtacaaccacatccacgccgcccat
gtcaacatcatcacccaccgctggacccgtatgaccatcgacggcaagccgcacccgcac
tccttcctccgggatggcgaggaaacccgcaacgtgcaggtcgatgtcgtcgagggcaag
ggtgttgacatcacgtcgtctctggccaagttgactgtgctgaagagcaccaactcgcag
ttctggggcttcctgcgcgacgagtacaccacactccctgagacatgggatcgtattctc
agcaccgatgtcgacgccagctggcagtggcgccggttcagcgggctggacgaggtgcgc
gctactgtgcctcatttcgatgcgacctgggcggcggccagggaaatcacccttaagacc
tttgccgaggacaactcggctagtgtgcagaacactatgtacaagatggcggagcagatc
ctggctcgtcagtccttgctcgagacggtcgagtactctctgcctaacaagcactacttt
gaagttgacctgagctggcacaagggcctgaagaacaccggcaaggacgccgaggtgtat
gcgccgcagaccaacccgaacgggctgatcaagtgcacggttggtcgcaacacgaaggcg
aagctgtag

DBGET integrated database retrieval system