KEGG   Aspergillus niger: ANI_1_826074Help
Entry
ANI_1_826074      CDS       T01030                                 

Gene name
An08g05850
Definition
mitogen-activated protein kinase mpkC
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ang  Aspergillus niger
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ang04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 366 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSARDQLTGQPVAVKKIMKPFSTPVL
SKRTYRELKLLKHLRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAACIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQT
ICSENTLRFVKSLPKRERQPLASKFKNADPDAVDLLERMLVFDPKKRIRAGEALAHEYLA
PYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMYSEILDFHNIDQANDAGQVLVEGAVAD
GQQAFA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcggaattcgtgcgtgcccagatcttcggcacaaccttcgaaattacaagcaggtac
acagacctgcagcctgtgggaatgggcgcttttggtcttgtctgctctgcgagggatcaa
ttgacaggacagccagtcgccgtcaagaagattatgaagccgtttagcacaccagttctg
tccaagagaacgtaccgcgagttgaaactgttgaagcatctacgacacgaaaatataatc
agtctcagtgatatcttcatttctccgctcgaagatatctatttcgtcacggaactcctg
ggaaccgacctccatagactcctcacttcccgacctctggaaaagcagttcattcagtat
ttcctctaccagattttgcgaggactaaaatatgtccactcggccggtgtcgttcatcgc
gatcttaagccgagcaacatcctcatcaacgagaactgtgatttgaaaatctgcgacttt
ggccttgcccgtattcaagacccccaaatgacaggctatgtctcgacccggtattatcgc
gctcccgagatcatgctcacatggcaaaaatacgatgtggaagtcgatatctggagtgca
gcctgcatctttgcggagatgctggagggaaagccactgttcccaggaaaggatcatgtc
aaccaattctcgattattacagaacttttgggcaccccgccggacgacgttattcagacc
atctgcagtgagaacactttgcgatttgttaagtcactgccgaaacgcgaacggcaacct
ttggctagcaagttcaagaatgccgaccccgacgctgttgatcttctcgagagaatgcta
gttttcgaccccaagaagcggatccgtgccggcgaagcgcttgcacatgaatatctcgcc
ccctaccacgaccccaccgacgaacccgtggcggaagagaagttcgattggtcctttaat
gacgccgacctgccggtggatacttggaagatcatgatgtactcggagattcttgacttc
cacaacattgatcaagccaacgatgctggccaagtgcttgtcgaaggagcagtcgcagat
ggacaacaggccttcgcatga

DBGET integrated database retrieval system