KEGG   Aspergillus niger: ANI_1_830164Help
Entry
ANI_1_830164      CDS       T01030                                 

Gene name
An18g06260
Definition
eukaryotic translation initiation factor 3 subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ang  Aspergillus niger
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ang03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 266 aa AA seqDB search
MAPSKWDDEEESVSPPPVVARRKFDDEEEEDVLDSWDAAEDSEVEREKAAKAAEAKAKAE
AEAAANKKSKAQRIQEKKAQRKADADAEDSDDSDEDEAERRARLRKTEKDADLKHAEDLF
GDIDLNRMRNRSAPKAVVISDGTDPTQAVDLSAMPLFKPATKDQFTRVTTTLIPLLTTQS
KKPQYALWAQDFIKQLVKDLPSGDVKKIASSLTTLSNEKMKEERAADKGNKKTKAAKTKV
SLVTSRENKIETNSYDDDGLDDDDFM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggctccttcaaagtgggatgacgaagaagagagtgtctctccccctcctgtggttgcc
cgccgcaagttcgacgacgaggaagaggaagatgtcctcgactcctgggacgccgccgaa
gattccgaagtagagcgtgagaaggccgccaaggcagcggaggccaaggctaaggcggaa
gccgaagccgccgccaacaagaagagcaaggcacagcggatacaggaaaagaaggcccag
cggaaggcagatgccgatgctgaggattcggacgacagcgacgaggacgaggccgagcgg
agagcccgtctccgcaagacggagaaggacgctgaccttaagcacgccgaggacctgttc
ggcgacatcgacctgaaccgtatgcgcaaccgcagcgcccccaaggccgttgtcatcagt
gacgggaccgacccgacccaggccgtcgatctgtcggctatgcctctcttcaagcccgcc
accaaggaccagttcacccgcgttacgaccacccttatccctctgttgacgacccagtcg
aagaagccccagtatgctctgtgggcgcaggacttcatcaagcagctcgtcaaggacctg
cccagcggtgatgtcaaaaagatcgcttcctcgctgactactctcagcaatgagaagatg
aaggaggagcgtgctgccgataagggtaacaagaagaccaaggcggccaagaccaaggtc
tctctggtcacctctagagagaacaagattgaaaccaactcttatgatgatgatgggttg
gatgacgatgacttcatgtga

DBGET integrated database retrieval system