KEGG   Aspergillus niger: ANI_1_846084Help
Entry
ANI_1_846084      CDS       T01030                                 

Gene name
An09g06490
Definition
lanosterol synthase
Orthology
K01852  
lanosterol synthase [EC:5.4.99.7]
Organism
ang  Aspergillus niger
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Lipid metabolism; Steroid biosynthesis [PATH:ang00100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 735 aa AA seqDB search
MSGSHIGPWRTPAQGHLTPDANGDLKTDYTRWRLRDDRGRQTWHYLESDAENEQWPQSIA
DKYFLGLPTGLPELPKPQTPLQCAENGLEFFSKLQLEPGNWACEYGGPMFLLPVLIITYY
VTKTPIPPEYATEIKRYLFARQHPEDGGWGLHIEAHSSVFGTCMNYVTLRLIGVSEDDPR
MIKARGLLHQFGGAIYGPHWAKFSLAVLGVMDWECVNPVPPEIWLLPDWVPFAPWRWWIH
IRQVFLPMSYLWSKRFSHPLDPLTKQLRQELYTQPYDSIDFAAHRNSIHKADNYYPKTWL
LNTLNSLLVNIWNPYLRVPAIVRRAEEWTWELVRMEDENTDYAGLGPVSNPFNMIVCYEH
DGPDSYSVRRHRERLHDYMWMKDEGMLMNGTNGVQVWDTAFITQSIVVAGFGDDPKWRPM
LTKALEFLEDHQLRENVPDQEKCYRQHRKGAWPFSNKTQGYTVSDCTAEGLRSTIQLQEM
HNFPKLISEERLKDSVDCLLLMQNPTGGFTEYETTRASEKVEWLNAAEVFGGIMIGYDYP
ECTTASVTALSLFSKYYPNYRAAEIKSAKEKAVQYIKRVQRADGSWYGSWGICFTYAAMF
ALESLASIGETYETSADSRRGCEFLISKQKEDGGWGESYLSSEKHVYVQHEKSQVVQTAW
ASLALMEAGYPHKEPLRKAMQLLMSRQQANGEWLQESIEGVFNQSCMISYPNYKLYWPIR
ALGLYARKFGNEELV
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggatctcacatcggcccgtggagaactcccgcccaaggccatctcacccccgac
gccaacggcgatctcaaaactgactatacgcgctggcgcctccgcgacgaccgcggccgc
caaacctggcactacctggaatccgacgcagagaacgagcaatggcctcaatccatcgca
gataagtacttcttgggtctccccacgggacttcccgagctccccaaaccccagacgcct
ctgcaatgcgccgagaacgggctggagttcttctccaagttgcagctggagccgggaaat
tgggcgtgcgagtatggcgggcccatgttcttgctgcctgtcttgattatcacgtactat
gttactaagacgcctattccgccggagtatgccaccgagattaagcggtatttgtttgct
aggcagcatcctgaggatggcggctgggggttgcatattgaagctcacagttctgtgttt
ggtacttgtatgaattatgttacgttgaggttaatcggtgtgagcgaggatgatcctagg
atgatcaaggccagggggttgttgcatcaatttggaggtgccatctatgggccccattgg
gcgaaattctcgctggctgtcttgggtgtgatggattgggagtgtgtgaatccggtgccg
ccggagatttggctacttcctgactgggtgccgtttgcgccctggcgctggtggattcat
attcgccaggtctttctgcccatgtcgtatctgtggtctaagaggttctcgcatcccttg
gaccctctcaccaagcagctgcggcaggagctgtatacccagccgtatgactcgattgac
tttgcggcgcatcgcaactcaattcacaaggcagacaattactaccccaagacttggctg
ctgaataccttgaactctctgctcgtcaacatctggaacccctaccttcgtgtccctgcc
attgtgcgtcgcgcggaggagtggacgtgggagttggtccgcatggaggacgagaatacc
gactacgctggcctggggcctgtgagcaacccgttcaacatgattgtgtgctacgaacat
gacggtccggacagctactcggtccgtcgccatcgcgaacggctgcacgactacatgtgg
atgaaggacgagggcatgctgatgaacggcaccaacggcgtccaggtatgggatacggcc
tttatcacgcagagtatcgtggtggccgggttcggcgatgacccgaaatggcggcccatg
ctcaccaaggcactggagttcctggaagaccatcagctgcgcgagaacgtgccggaccag
gagaagtgctaccgccagcaccgcaagggcgcatggccattcagcaacaagacgcaggga
tacacggtcagcgactgcaccgccgagggactgcgctcgaccatccagctgcaggagatg
cacaacttcccgaaactgatctcggaggagcgattgaaggacagcgtcgactgcctgctc
ctgatgcagaaccccactggtgggttcaccgagtacgaaaccacgcgggcatccgagaaa
gtcgagtggctcaacgcagccgaggtgttcggcgggatcatgatcggatacgactatccc
gagtgcacgaccgcgtccgtcaccgcgctctccctcttcagcaaatactatccgaattac
cgggctgcagagatcaagtccgccaaggaaaaggccgttcagtacatcaagcgggtgcag
cgcgccgatggcagctggtacgggtcctggggcatctgcttcacgtacgcggcgatgttt
gccctggagagtctggccagcatcggagagacgtacgaaacgagcgcggactcccgacgc
ggatgcgagttcctcatctcgaagcaaaaggaggacggcggctggggcgagtcgtacctc
agcagcgagaagcacgtctatgtgcagcacgagaagtcgcaggtcgtgcagacggcatgg
gccagtctggcattgatggaggccgggtatccgcataaggagccgctgcggaaagcaatg
cagctgctgatgtcgcggcagcaggccaatggagagtggttgcaggagtcgattgaggga
gtgtttaaccaatcttgcatgatttcgtatcccaactataagctgtactggccgatccgg
gccttgggattgtatgcgcgcaagtttggcaatgaggagttggtctga

DBGET integrated database retrieval system