KEGG   Aspergillus niger: ANI_1_852074Help
Entry
ANI_1_852074      CDS       T01030                                 

Gene name
An08g06080
Definition
N-(5'-phosphoribosyl)anthranilate isomerase
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
ang  Aspergillus niger
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ang01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ang00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 770 aa AA seqDB search
MADSGLVDHSPHHPTKAAQLNTASNVILIDNYDSFTWNVYQYLVLEGATVNVFRNDQITL
EELIAKKPTQLVISPGPGHPETDAGISSAAIQYFSGKIPIFGVCMGQQCIITCFGGKVDV
TGEILHGKTSALKHDGKGAYEGLPDSLAVTRYHSLAGTHATIPDCLEVSSSVQLTDDSNK
DVIMGVRHKKLAVEGVQFHPESILTEYGRTMFRNFLKLTAGTWEGNGKHFDEQSNTTKAT
VSSNTAPKTDKKLSILERIYDHRRAAVAVQKTIPSQRPADLQAAYDLNLAPPQVPFPARL
RQSPYPLSLMAEIKRASPSKGMIAENACAPAQARQYAKAGASVISVLTEPEWFKGSIDDL
RAVRQSLEGLTNRPAILRKEFVFDEYQILEARLAGADTVLLIVKMLSVELLTRLYHYSRS
LGMEPLVEVNTPEEMKIAVDLGAEVIGVNNRDLTSFEVDLGTTSRLMDQVPSSTIVCALS
GISGPKDVEAYKKEGVKAILVGEALMRAADTAAFIAELLGGSSQNVSKESRSSPLVKICG
TRSEEAARAAIEAGADLIGIIMVQGRTRCVPDDVALRISQVVKSIPKPAGQTPPTSRGTP
AAASVEYFDHSARILRHPSRALLVGVFQNQPLDYILSQQQKLGLDVVQLHGSEPLEWAKL
IPVPVIRKFGLDEPAIARRAYHSLPLLDSGVGGTGELLDQSRVQNVLDKDSGLRVILAGG
LDPTNVAGIVQKLGESGRKVVGVDVSSGVESDGAQDLGKIRAFVQAVRGL
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcggactccggactcgtcgatcattccccccaccatcccaccaaggccgcccagttg
aacacggcatcgaatgttatcttgattgataactacgactcgtttacctggaacgtttac
cagtacttagtccttgagggtgctactgtcaatgtatttcgtaatgaccagatcactttg
gaggaactgatcgccaaaaaacccacccagctggttatcagtccgggccccggtcacccc
gagactgacgctggtatcagcagtgcggccatccaatacttcagtggcaagattcccatc
ttcggtgtgtgcatgggccagcaatgtattattacttgctttggtggaaaggttgatgtc
accggcgaaattcttcacggcaagacgtccgcgcttaaacatgacggcaagggcgcctat
gaaggactacctgactcgctcgccgtcactcgttaccactcgctagctggtacacatgcg
acaattcccgactgtctggaggtgtcctcttccgtccagttaacggacgatagcaacaag
gatgtcatcatgggtgtgaggcacaagaaattggctgtggagggagtccagttccacccc
gagagtatcctcactgagtacggccgtaccatgttccgcaacttcctcaaacttactgca
ggtacctgggaaggaaacgggaagcattttgatgaacagagcaacacgaccaaggccacc
gtttcctcaaacactgccccgaaaactgacaagaagttgtccatcctcgaaaggatttac
gaccatcggagagccgctgttgccgtgcaaaagaccattccctcccagcggccagcagac
ctccaggctgcctatgaccttaacctggcccctccccaggtcccatttccggctcgtctt
agacaatcgccctatccactgtcccttatggcggaaatcaagcgtgcttctccctccaag
ggtatgatagccgaaaacgcgtgtgcgcccgctcaggccaggcaatacgcgaaggccggt
gccagtgtcatctctgtgctcacagagcctgaatggttcaaaggcagcattgacgacttg
cgtgccgttcgccaaagtctggagggcttgacgaacaggcccgccattctgcggaaggaa
ttcgttttcgacgaatatcagatcctagaggcccgtttggccggtgctgacacggtcttg
ctcattgtgaagatgcttagtgttgaactcctcactcggttgtatcactactcccgtagc
cttggcatggagcctttggttgaagtgaacacacccgaagagatgaagattgcggtcgat
cttggagctgaggttatcggtgtcaacaacagagacctcactagtttcgaggttgatctc
ggcactactagccggctcatggatcaggtgcccagcagcaccattgtgtgtgccctcagt
ggaatctccgggcctaaggatgtggaagcttacaagaaggagggtgtcaaagctatccta
gtaggagaagcccttatgcgggcagcagacacggctgctttcattgctgagcttcttgga
ggcagctcacagaacgtttccaaagagtcccggagttcgccgttggtaaagatctgcggc
actcgttctgaagaagcagcacgagcggcgatcgaggctggagcagacctaattggaatt
atcatggttcagggacgaacgcgatgcgtccctgatgacgtggccctccgtatatctcaa
gtggtcaagtccatcccgaagcctgctggtcaaactcctcccacatctcgaggaactccc
gctgcagcatctgttgagtattttgaccactcagccagaatcctacgtcatcctagccgg
gcgcttctcgtgggcgtcttccagaaccaaccccttgattatattttgagccagcaacaa
aagctgggactcgatgtcgtgcaacttcacggatctgagccgcttgaatgggccaaattg
atcccagtgcctgtcatccgcaagtttgggcttgacgagcctgcgatcgcccgcagggct
tatcactccctaccattactggattctggcgttgggggaactggtgagttgctggaccag
tcccgcgttcagaacgtcctcgataaggatagcggtttgcgcgttattctggcaggtggc
ttagatcccaccaatgttgctggcattgtccagaagcttggcgaatccggtcgcaaggtc
gttggcgtcgatgtcagttctggcgtagagtcagacggtgctcaggatcttggcaaaatt
cgcgcctttgtgcaggccgtgaggggactctag

DBGET integrated database retrieval system