KEGG   Aspergillus niger: ANI_1_86124Help
Entry
ANI_1_86124       CDS       T01030                                 

Gene name
An14g00480
Definition
TFIIH and nucleotide excision repair factor 3 complexes subunit
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ang  Aspergillus niger
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    ANI_1_86124 (An14g00480)
  Replication and repair
   03420 Nucleotide excision repair
    ANI_1_86124 (An14g00480)
Transcription machinery [BR:ang03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ANI_1_86124 (An14g00480)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MAAAPSSRPFEYLESLAGTVFYKLYQQPSTALAIFRRMLPDLAKCFVMALLYLKDPLPAA
DLEAWVKSESLKERDNALSILGRLHILSNTVTADNVRAYKVTDPFATSLRHALTGADQTQ
SFGVLSQVPAGSEVSIPELDEYARRQWEGVLGYMVGTGGMGGPQVTLSKGVKELLQAGHL
VEIRDRRVEITQDGFAFVLQDVSTQVWHILILYVESASAIKMDSVEVLSFVFLLSSLELG
KSYEKNHLSSKQLRMLTDLADFGIVYQESPDAPRFYPTRLATTLTSDSSALSNPLLGSLS
GPAGEASSKAGTGFIIIETNYRVYAYTSSPLQISLIALFTTLKYRFPNLITGKITRQSVR
RAVEMGITADQIISYLSTHAHPQMRKHNVSRSTSNQAGIPPSVLPPTVVDQIRLWQLERD
RVKATSGFLFKDFVSLAEYEAPCRYAEEIGVLAWKSDRKRMFFVTRHEQVAAFLRSRK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcaccatcttctcgtccctttgaatacctcgaaagccttgctggcactgtc
ttctacaaactttaccagcagccatcaacggctctcgccattttcaggcgcatgctgcct
gatctggcaaaatgctttgtcatggcacttctctacctaaaggatccgctccccgcggcg
gatctggaggcttgggttaaatcggagagcttgaaagaacgcgacaatgcactctccatc
ctaggaagactgcatattttatccaacactgttacggcggataatgtccgcgcctacaaa
gtcaccgatcccttcgccacttcattgcgacacgctctcaccggcgccgaccaaacacaa
tcttttggcgtcctttcacaagtgcctgctggctcggaagtctcgatccccgaacttgat
gagtatgcgcgacgacagtgggaaggagtgctgggatacatggtcggtactggaggcatg
ggaggtccccaagtgaccctcagcaaaggcgtgaaggagctcctgcaggcgggtcatctg
gtcgagatccgagatcgtcgcgtcgaaatcacccaggatgggtttgcctttgtcctgcaa
gatgtcagcacgcaggtgtggcatatcttgattctttacgtcgagagcgccagcgccatc
aagatggacagtgtcgaagtcctctcgttcgtgttccttctcagcagtctcgaactcgga
aaatcatatgaaaagaaccacctcagttcgaaacaactgcgcatgctgaccgaccttgcc
gactttggtatcgtctatcaagaatcgccggatgcaccgcgtttctaccccacccgtctt
gcaaccaccctcacgtccgactccagcgccttgagcaacccactcttgggttccctctcc
ggtcctgctggcgaagcctccagcaaagcgggtacgggcttcatcattatcgaaaccaac
taccgtgtatacgcatacacctcgtctcccctacagatctccctgattgctctgttcacc
acactgaaataccgcttccccaacctcatcaccggcaaaatcacccgccaatccgtccgc
cgggccgtcgagatgggcatcaccgccgaccaaatcatttcctatctctctactcacgcc
cacccgcaaatgcgcaagcacaacgtctcccgctcgacctcaaaccaggccgggatcccc
ccgtcagtcctcccgccaaccgtggtggaccagattcgactttggcagctggagcgggac
cgtgtcaaagctacgtccggattccttttcaaggactttgtcagtctggcagaatacgag
gcgccatgtcgctatgccgaagaaatcggtgttctggcatggaagtcggatcgcaaacgc
atgttcttcgtgacgaggcatgaacaagtggctgcgttcttaaggagccggaaataa

DBGET integrated database retrieval system