KEGG   Aspergillus niger: ANI_1_884074Help
Entry
ANI_1_884074      CDS       T01030                                 

Gene name
An08g06320
Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ang  Aspergillus niger
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ANI_1_884074 (An08g06320)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    ANI_1_884074 (An08g06320)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     ANI_1_884074 (An08g06320)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1156 aa AA seqDB search
MAYAAASSPSTINGDTQASLKLTGSLPKPPKLHNVNTSVPPAPNPSSAPPCASLYSYTPN
SLRPSYTFSNASSPSGTPLQSATDALRGRIPSFPLIPPAHLELGDSIMAVPGSASASGSG
DAATQTTNKGPGLMRRISRGAANKLTRRRQSATQNDKRDRSSGPVIMRRRSDSKTGQNSW
ESALESSNEEDSNDALDSLGVWCGSEASSLQNEMFIPPTRTVSAVAPKVDAMIQRGVIFT
KITKKRRKQVRFFLDLDAGKVYWDLSNPTKRFYVDDIKEIRVGVDARNYREEHQVSQDFE
SRWITVVIADAERSKGRSVKTLHLIAPSDYTLELWTTTLEHISRYRIGLMAGLAGSGQSE
AVLKAHWQREMTRLYPKGLKLGELESLDFEAVESVCRSLHINCSKNMLRAQFSKADNNNK
GKLYFSEFSDFVARLKERKDVKAIFKERVASSEGFTLEEFLAFLRDVQNEDVESDRSYWV
SIFDRLVRKSRPRAPSLPEHPDGRPTGVPRLGLDAFTSFLSSSWNGVYASRAPQSRFDRP
LNEYFISSSHNTYLLGRQVAGASSTEAYISALSQGCRCVEIDCWDGADGRPIVSHGRTMT
TSVLFADCITVINRYAFISTDFPLILSLEVHCNPEQQLAMVRIMKETFKDQLVLEPLLTN
TFVLPSPEDLKRRILVKVKTCDETEGGMRQESTGSSISVGRKRSSSSPFMHPTVPEYPPV
SNLVPLAGPSTAGQDGIDTFLSQDRRSFTTTSISSATEDSDGALTSMKRERKRRQKSKIT
KPLSDLGVYTRGYKWHSFTSPESQRYNHVYSFAERSFESICRDADNKAVFEKHNRKYLTR
VYPSGFRLRSSNFDPLKFWRRGVQMAALNWQTYDVGMQLNQAMYAAGTDRTGYVLKPESL
RTVTTGEDRRKSTERKCVRFTIEVVSAQQLPRPRSLGPDDNINPYVEVEIFSADDRGQSF
VFGEGGLNTSARSGVSGIGYPHRRRTKIEQSNGYSPIFNDCFKFALDTKYPDLVFVRWTV
WSSLDGRSAGNNSSVQLATFTAKLTSLSQGYRYLPLYDAGGDQYLFSTLFCKITKDGITP
AYFGRIDPDDLRAERLGLLRQIGQTVFKRSSSTEREKDSFSDKGSEIPMSSEDNHSPTSP
TLTPTVSAASTSSLPP
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgccgctgcttcgtcgccttcaaccataaatggcgacacccaagcaagttta
aaacttactggctcactcccgaaacctccaaaactacataatgtcaacacatctgttccc
cccgcccccaatccctcctccgctccgccctgtgcctctctttactcatatacacctaac
tcattacgtccttcatacaccttctcaaatgcttcgagcccttccggcacccctctacaa
tcggctactgacgcgctccgtggtcgaataccctcattccctctgatacccccagcccat
cttgagcttggagattcaatcatggctgttcctgggagtgctagtgcttccgggtcgggg
gatgcggcaactcaaacgacaaacaaaggcccaggattgatgcgcagaatctcccgagga
gcagccaacaagctcactcggaggcggcaatccgcgacccaaaatgataagcgggaccgt
agctccggtcccgttatcatgcgcagacgcagtgacagcaaaactggacaaaatagctgg
gaaagtgcgcttgagtccagtaatgaagaagacagcaatgatgctctggactctctggga
gtttggtgtggctctgaggcttctagcttgcagaacgagatgtttattccccctactcgc
acggttagtgcagttgcaccgaaagttgatgcaatgattcagcgcggcgtaatcttcacg
aaaatcaccaagaaacgacggaagcaagtgcgcttctttctcgatctcgacgctggcaaa
gtttactgggatctttcgaatccgacgaaaaggttttatgtcgatgacattaaggagatt
cgcgtgggtgtcgatgcgcgcaattatcgtgaggaacatcaggtttcacaggatttcgaa
agtagatggatcaccgttgtcatcgccgacgcagaacgatcgaagggacgatctgtcaag
acactgcacctgattgcgccgagtgattatacccttgagctttggacgacaaccctggaa
cacatctcacgctatagaattggtcttatggctggcctagctggttctggccagagtgag
gcggtcttgaaagcccactggcagcgtgagatgaccagattatatccaaagggtttaaag
ctcggcgagctcgagagcttggatttcgaggcggttgagagtgtatgccgcagcttgcac
atcaattgctccaagaatatgctccgcgcccaattctctaaggcggacaataacaacaag
ggcaagttatatttctccgagttcagtgattttgttgctcgtttgaaggagcggaaagat
gtcaaagctatcttcaaagagcgtgttgcaagttctgaaggctttactttggaagaattc
ctagcattccttcgtgacgtgcagaacgaagatgtcgagtctgaccgaagctactgggtg
tctatttttgatcggcttgtgcgcaaatcaaggccccgtgcacccagtcttccagagcat
ccggacggaagacccactggagttccgcgtctgggtcttgatgctttcacctcgtttcta
tcttcttcttggaatggggtctatgcctcccgcgccccccagtccaggtttgatcgtcct
ttgaacgaatacttcatctccagctcgcacaatacgtacctcctaggtcgccaggtagct
ggtgcgtccagcaccgaggcatacatcagcgctttgtcccaagggtgtcgttgtgtggag
atcgattgctgggacggagctgatggccgacccattgtctctcacggaaggaccatgact
accagcgtcctcttcgccgactgcatcactgtcatcaacagatacgcattcatcagcaca
gactttccgcttatcctctctctcgaagttcactgcaatcccgagcaacaactagccatg
gtgagaatcatgaaggagaccttcaaagaccaattagtcttggaaccccttcttacaaat
acgttcgtccttccgtcgcccgaggatttgaagcgtcgcatccttgtgaaagtcaaaact
tgcgatgaaacagaaggtggcatgcgacaagagtctacgggttcctcgatcagcgtcggt
cgaaagcgcagctcaagctccccatttatgcacccgacggtgcctgagtaccctccagtt
tccaaccttgtacctcttgctgggccttccacggctggccaggatggtatcgatacattc
ctttcccaggatagacggtccttcacgaccaccagcataagcagcgccacggaagacagt
gatggcgcattgacgtccatgaaaagggaacggaaacgacgccagaagagcaagataacc
aagccattgtcggacttgggagtgtatactcgaggctacaaatggcatagcttcacgtcc
ccggaaagccagcggtataaccacgtgtactcgttcgcagagcgttctttcgagagtatc
tgccgcgatgcagataacaaagctgttttcgagaagcacaatcgaaagtatctgacaagg
gtctatccatctggcttccgtctgaggtcctctaacttcgatcccctcaaattctggcgt
cgcggagtgcagatggccgctttgaactggcaaacctacgatgttggaatgcagttgaac
caagccatgtatgccgccgggactgatcggacaggctacgtacttaagcccgagtctctt
cgcacagtgaccactggcgaagatagaagaaagagcacggagcggaaatgcgttcggttt
acgatcgaagtcgtctctgctcagcaactaccgcgccctcgcagccttggaccggacgat
aatatcaatccgtacgtggaggttgagatatttagtgccgatgatcgaggtcagagcttc
gtatttggggaaggtggcctgaacacttcggcgcgcagtggcgtgtcaggcattggctat
ccgcaccgtcggcgcacgaaaatcgagcagagcaatgggtacagccccatcttcaatgat
tgcttcaagtttgcgctggacacgaagtatcccgaccttgtgtttgtccgttggacggtc
tggagctcgctggacggccgcagtgcagggaacaacagcagtgtccagttggccaccttt
actgccaaacttaccagcctttctcaaggataccgctatctgccgttgtatgatgcaggc
ggcgaccaatatctcttttcaactctgttctgcaagattactaaggatggtatcactccc
gcctactttggacgaatcgatcccgatgaccttcgcgctgagcgattgggtcttctccgt
caaatcggtcaaaccgtgttcaagcgctcgtcatccacggagcgggagaaggactctttc
tccgacaagggtagtgagatcccgatgagctcagaggacaaccattctcctacgtctccg
actctgacgccaacagtgtcagcggcatctacttcttcgctgcctccttag

DBGET integrated database retrieval system