KEGG   Aspergillus niger: ANI_1_884074Help
Entry
ANI_1_884074      CDS       T01030                                 

Gene name
An08g06320
Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ang  Aspergillus niger
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ang00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ang04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1156 aa AA seqDB search
MAYAAASSPSTINGDTQASLKLTGSLPKPPKLHNVNTSVPPAPNPSSAPPCASLYSYTPN
SLRPSYTFSNASSPSGTPLQSATDALRGRIPSFPLIPPAHLELGDSIMAVPGSASASGSG
DAATQTTNKGPGLMRRISRGAANKLTRRRQSATQNDKRDRSSGPVIMRRRSDSKTGQNSW
ESALESSNEEDSNDALDSLGVWCGSEASSLQNEMFIPPTRTVSAVAPKVDAMIQRGVIFT
KITKKRRKQVRFFLDLDAGKVYWDLSNPTKRFYVDDIKEIRVGVDARNYREEHQVSQDFE
SRWITVVIADAERSKGRSVKTLHLIAPSDYTLELWTTTLEHISRYRIGLMAGLAGSGQSE
AVLKAHWQREMTRLYPKGLKLGELESLDFEAVESVCRSLHINCSKNMLRAQFSKADNNNK
GKLYFSEFSDFVARLKERKDVKAIFKERVASSEGFTLEEFLAFLRDVQNEDVESDRSYWV
SIFDRLVRKSRPRAPSLPEHPDGRPTGVPRLGLDAFTSFLSSSWNGVYASRAPQSRFDRP
LNEYFISSSHNTYLLGRQVAGASSTEAYISALSQGCRCVEIDCWDGADGRPIVSHGRTMT
TSVLFADCITVINRYAFISTDFPLILSLEVHCNPEQQLAMVRIMKETFKDQLVLEPLLTN
TFVLPSPEDLKRRILVKVKTCDETEGGMRQESTGSSISVGRKRSSSSPFMHPTVPEYPPV
SNLVPLAGPSTAGQDGIDTFLSQDRRSFTTTSISSATEDSDGALTSMKRERKRRQKSKIT
KPLSDLGVYTRGYKWHSFTSPESQRYNHVYSFAERSFESICRDADNKAVFEKHNRKYLTR
VYPSGFRLRSSNFDPLKFWRRGVQMAALNWQTYDVGMQLNQAMYAAGTDRTGYVLKPESL
RTVTTGEDRRKSTERKCVRFTIEVVSAQQLPRPRSLGPDDNINPYVEVEIFSADDRGQSF
VFGEGGLNTSARSGVSGIGYPHRRRTKIEQSNGYSPIFNDCFKFALDTKYPDLVFVRWTV
WSSLDGRSAGNNSSVQLATFTAKLTSLSQGYRYLPLYDAGGDQYLFSTLFCKITKDGITP
AYFGRIDPDDLRAERLGLLRQIGQTVFKRSSSTEREKDSFSDKGSEIPMSSEDNHSPTSP
TLTPTVSAASTSSLPP
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgccgctgcttcgtcgccttcaaccataaatggcgacacccaagcaagttta
aaacttactggctcactcccgaaacctccaaaactacataatgtcaacacatctgttccc
cccgcccccaatccctcctccgctccgccctgtgcctctctttactcatatacacctaac
tcattacgtccttcatacaccttctcaaatgcttcgagcccttccggcacccctctacaa
tcggctactgacgcgctccgtggtcgaataccctcattccctctgatacccccagcccat
cttgagcttggagattcaatcatggctgttcctgggagtgctagtgcttccgggtcgggg
gatgcggcaactcaaacgacaaacaaaggcccaggattgatgcgcagaatctcccgagga
gcagccaacaagctcactcggaggcggcaatccgcgacccaaaatgataagcgggaccgt
agctccggtcccgttatcatgcgcagacgcagtgacagcaaaactggacaaaatagctgg
gaaagtgcgcttgagtccagtaatgaagaagacagcaatgatgctctggactctctggga
gtttggtgtggctctgaggcttctagcttgcagaacgagatgtttattccccctactcgc
acggttagtgcagttgcaccgaaagttgatgcaatgattcagcgcggcgtaatcttcacg
aaaatcaccaagaaacgacggaagcaagtgcgcttctttctcgatctcgacgctggcaaa
gtttactgggatctttcgaatccgacgaaaaggttttatgtcgatgacattaaggagatt
cgcgtgggtgtcgatgcgcgcaattatcgtgaggaacatcaggtttcacaggatttcgaa
agtagatggatcaccgttgtcatcgccgacgcagaacgatcgaagggacgatctgtcaag
acactgcacctgattgcgccgagtgattatacccttgagctttggacgacaaccctggaa
cacatctcacgctatagaattggtcttatggctggcctagctggttctggccagagtgag
gcggtcttgaaagcccactggcagcgtgagatgaccagattatatccaaagggtttaaag
ctcggcgagctcgagagcttggatttcgaggcggttgagagtgtatgccgcagcttgcac
atcaattgctccaagaatatgctccgcgcccaattctctaaggcggacaataacaacaag
ggcaagttatatttctccgagttcagtgattttgttgctcgtttgaaggagcggaaagat
gtcaaagctatcttcaaagagcgtgttgcaagttctgaaggctttactttggaagaattc
ctagcattccttcgtgacgtgcagaacgaagatgtcgagtctgaccgaagctactgggtg
tctatttttgatcggcttgtgcgcaaatcaaggccccgtgcacccagtcttccagagcat
ccggacggaagacccactggagttccgcgtctgggtcttgatgctttcacctcgtttcta
tcttcttcttggaatggggtctatgcctcccgcgccccccagtccaggtttgatcgtcct
ttgaacgaatacttcatctccagctcgcacaatacgtacctcctaggtcgccaggtagct
ggtgcgtccagcaccgaggcatacatcagcgctttgtcccaagggtgtcgttgtgtggag
atcgattgctgggacggagctgatggccgacccattgtctctcacggaaggaccatgact
accagcgtcctcttcgccgactgcatcactgtcatcaacagatacgcattcatcagcaca
gactttccgcttatcctctctctcgaagttcactgcaatcccgagcaacaactagccatg
gtgagaatcatgaaggagaccttcaaagaccaattagtcttggaaccccttcttacaaat
acgttcgtccttccgtcgcccgaggatttgaagcgtcgcatccttgtgaaagtcaaaact
tgcgatgaaacagaaggtggcatgcgacaagagtctacgggttcctcgatcagcgtcggt
cgaaagcgcagctcaagctccccatttatgcacccgacggtgcctgagtaccctccagtt
tccaaccttgtacctcttgctgggccttccacggctggccaggatggtatcgatacattc
ctttcccaggatagacggtccttcacgaccaccagcataagcagcgccacggaagacagt
gatggcgcattgacgtccatgaaaagggaacggaaacgacgccagaagagcaagataacc
aagccattgtcggacttgggagtgtatactcgaggctacaaatggcatagcttcacgtcc
ccggaaagccagcggtataaccacgtgtactcgttcgcagagcgttctttcgagagtatc
tgccgcgatgcagataacaaagctgttttcgagaagcacaatcgaaagtatctgacaagg
gtctatccatctggcttccgtctgaggtcctctaacttcgatcccctcaaattctggcgt
cgcggagtgcagatggccgctttgaactggcaaacctacgatgttggaatgcagttgaac
caagccatgtatgccgccgggactgatcggacaggctacgtacttaagcccgagtctctt
cgcacagtgaccactggcgaagatagaagaaagagcacggagcggaaatgcgttcggttt
acgatcgaagtcgtctctgctcagcaactaccgcgccctcgcagccttggaccggacgat
aatatcaatccgtacgtggaggttgagatatttagtgccgatgatcgaggtcagagcttc
gtatttggggaaggtggcctgaacacttcggcgcgcagtggcgtgtcaggcattggctat
ccgcaccgtcggcgcacgaaaatcgagcagagcaatgggtacagccccatcttcaatgat
tgcttcaagtttgcgctggacacgaagtatcccgaccttgtgtttgtccgttggacggtc
tggagctcgctggacggccgcagtgcagggaacaacagcagtgtccagttggccaccttt
actgccaaacttaccagcctttctcaaggataccgctatctgccgttgtatgatgcaggc
ggcgaccaatatctcttttcaactctgttctgcaagattactaaggatggtatcactccc
gcctactttggacgaatcgatcccgatgaccttcgcgctgagcgattgggtcttctccgt
caaatcggtcaaaccgtgttcaagcgctcgtcatccacggagcgggagaaggactctttc
tccgacaagggtagtgagatcccgatgagctcagaggacaaccattctcctacgtctccg
actctgacgccaacagtgtcagcggcatctacttcttcgctgcctccttag

DBGET integrated database retrieval system