KEGG   Aspergillus niger: ANI_1_892124Help
Entry
ANI_1_892124      CDS       T01030                                 

Gene name
An14g06530
Definition
cullin-4B
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ang  Aspergillus niger
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ANI_1_892124 (An14g06530)
Messenger RNA biogenesis [BR:ang03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     ANI_1_892124 (An14g06530)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 2539 aa AA seqDB search
MEERDAATGLRGLYQDLSALSASSFVNIERLRVELETHIDDFKKLLDKPPKNNTSRQAVL
SGKITVDDLEYSINEEFQQGALMLADALDLDELQAAMLFMAAQEDAPVLDRPPVIAAIMR
FHERRQFLLDSLRLIFQESFEVEREMTQVLMQEMLAFVVEIKDGPLRNASLFTRKCMKSM
EDIERWLVLLNEQTQKASIVGQSAEYDIVEALEYQRSSLQQQHESLGAVLCYLFKGPYTS
SEDLRLLLDHLRKLERFDGLLIHYLPCIIASFVQHGSPESSSSYRDARSLHTAITSSKDV
QPWKVPTFHSAVVALWLAVYSGWDFDGPASPLQGVDLEKDSEERTKMFMTALDDGGLELI
LAVCYGVNDEEWADPARSELVTLLLKESASATLETDSCSDFLKVLLMENFEAFAEACIAN
MPDAVRMLKTEEDSQRLDHLTALRDGLTSSLHRGLVEARTHLESFLMIMAFAFEHRPDAA
QEFWADPDGNLYGFLQWASKRQTVPRVSAFCELLCSISVGEDNATAAHRFLSEEDKFMSA
KFKRSTSMNWSQMFAELQLYATRVTEKPSTSQAILRSRKLDPADMSEPESPVMLTCYLRL
LEHLSKQSATIRDWLLHHPTFNVVGTLLTLCSGPIPTHLRANVFAALAALMTDRTSHNGN
EMWLSIDQWISGGSMSASNLGKVPVVSNPLVWHEQQAFQRIGESFDQANAFVRLVYSLIS
PALDSADFHLSLPFPESLGSSYRMPGIEPYIDFVMGQALSRKIPDLNERQTRFLTYNCLD
FIVTCLQSFNESLVSVLSQPTVSTDSIVKQSTFVTYIRLHPFARVTEWLFNEDVIKAIFA
TAHQDVNEVAKASSDSVLVQSLVRSLEVMDMMIDLQSTYFNIVRPAIKAQTGTSRTNVAN
SALSAFEDSILNNLSIIPALCLYCSTGHQQLTVTSMALLEKLSSSRKLNKITSPELSKWR
SPNKIVEVLSAEVDLNSVSRPLVSQMQPESREIEAGPQSPGYIIRESLLALLNSCLSTIN
DRPTIAHLLLGFNSIGNILDIAPDSLFADKMSLLHAVIGFLQNYPDALDGNILPWLVHVK
RMAFGVLKHLWSSKLSSYFTLAEMRGSRFLLSMFACQPIIGPNTPWDGFLIGTPEFWLSE
STAGLAEFLLYRSYLFEYAATEIRSATKLGSPTLQAEIISTLFGNSVSETGETIVNPSVF
DLFDFADLDTQHQLQPPALSFLDGIEFDACARPETDSSPIVYNLDEIVELVQVRKEELSL
SGHLRPQDEELFQAESESLILFIRSTNQASQIAFNRYLALRSWTQLITTMLTCSEIDGGR
RATFILHSLQLILPKLEIAIEEDLPEGLELARLAETLVSRLESTKPGSGNPRRSGDVLDE
KLHQLFQVCVRGVTLANGNVSIRETFYNTCAHYVAGIISTEPVHQSMKFQSQQVIKAAGH
ALIEAVCDDAYAGQETCRVSALLLLNLLAALDRQADGLLADSISQSNYLSLFLDTIRSLP
IELRNAQASDTPLLLSYYQSLLSLLQELCQTKNGATYVLKTGLFQAVRDSQLFAADPDLG
IDIDNPDALRKYYDLLDSVLRVVVAAVFSRGLHNEQMLEQTRVFLAENRQSMVGIFKRFA
KLGGAGAADHHDALRKLTKSYLALITATDFLDNSRGTTEQRSGKRKSIGKRKLSDQEEAL
QQPQQQQANISEFLSRNHTTPARGHHQQTSPTSKRLRLSPPSSDSVPSAYSRDRSASDRM
YNFANAESRPGAPMGQSASGADLPNTTTKPRTFNATSRQNNFTPHTGAKRLVVKNLRTGS
RLNQESYFEKIWGQLDAALSAIFGGGKPEVSLEELYKGAENVCRQGRAAVLAKRLQDRCR
EHVSGRLRDKLVAKAADGSNVDTLRAVVEAWSQWQSKLVTVRWIFYYLDQSFLLHSKEFP
MIREMGLIQFRQHIFSDAVLQPKILQGACDLVEADRGEEQSVVADSLLLRNTIELFHGLD
IYTTGFEPLLISESKKYFSSWAQREATGYLATFAENSHRIIEREVTRCELFSLNRSTKQM
LSELLDRALVTEQENVLLNQPDILGLLRAGNKVALERLYSLLQRKDLGAKLKAAFSGYII
EEGSGIVFDEDKEADMVAHLLEFKQQLDDIWVNSFHRNEELGHTLREAFETFINKGRKSE
STGGTDNPKTGEMIAKYVDRLLKGGWKLAPARKAEDMPLADEDAEIDRQLDQVLDLFRFV
HGKAVFEAFYKNDLARRLLMGRSASDDAEKSMLARLKTECGSSFTHNLESMFKDMDVARD
EMSAYSSIQRERRDRLPVDLNVSVLSASAWPTYPDVQVRIPPEIATAVDDFEKFYNTKYN
GRKLNWKHQLAHCQLRARFPKGDKELVVSSFQAIVLLLFNDIPEGGSLGYAQIQEATMLS
DQELKRTLQSLACAKYRVLSKKPKGRDVNTTDEFSYNAAFTDPKMRIKINQIQLKETKEE
NKTTHERVAADRHYETQAAIVRIMKSRKTITHAELVAEVIKATRSRGVLEPADIKKNIEK
LIEKDYMEREEGNRYQYVA
NT seq 7620 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaagagatgctgcaacaggccttcgtggcctgtatcaggatctctctgctctt
tcggcttcgtcctttgtcaacatcgagcgtcttcgagtcgagctggagactcacatcgat
gatttcaagaagctcctcgacaaacctccaaagaacaacacaagtcgccaggcggtcctc
tccggtaaaattaccgtcgacgacctcgagtactcgatcaatgaagaatttcaacaggga
gcgttaatgctggcagatgcgctggatctcgatgaattgcaagcggcaatgctgtttatg
gcggcgcaggaagacgctcctgtcttggataggcctcccgtcatcgctgcgattatgcga
ttccatgagcgccgacaattcttgctcgactcattacggcttattttccaggagtccttc
gaggtggagcgggagatgacacaggttctcatgcaggaaatgttggcatttgtggttgaa
ataaaggatgggccgttgcgaaatgcgtcactattcacgcgcaaatgcatgaagtcgatg
gaagacatcgagaggtggcttgtcctccttaacgagcaaacccaaaaagcctccatcgtt
ggtcagtcagcggaatacgacatcgtggaggctctcgaataccaacgcagcagcttacag
caacaacatgaatcccttggtgctgtgctatgctacctattcaaaggaccttacaccagt
tcggaggatctccgcttactcctggaccaccttcggaagctcgaacgtttcgatggactc
cttattcactaccttccttgcataattgcctcttttgttcagcatgggtctccagaaagc
tctagttcttatagggacgctagaagcctacatacagcgatcacatcctccaaagacgtt
caaccctggaaggttcccacgttccactctgcggtcgtcgcactatggctcgctgtctac
agcgggtgggatttcgatgggcctgcctctcctctccagggagtggacttggagaaagat
tcagaagagcgcacaaagatgttcatgactgctctggatgatggaggcctcgaactcatc
ctcgccgtctgctatggcgtgaatgatgaagaatgggccgatccggcccgtagtgaactg
gtcacgttactattgaaagaaagcgcgtcggcaacactggagacggatagttgctcggat
ttcttaaaggttcttctgatggagaattttgaggcctttgccgaggcatgtatagcgaac
atgcccgatgcggtgcggatgttgaagaccgaagaggattcgcaaagactggatcatctt
acggctttacgagacggtttgacttcgagcctccatcgtggcctggtagaggcccgaaca
catcttgagtcgttcttgatgatcatggcattcgcgttcgagcatcggccagatgccgca
caggaattctgggctgatcccgatggtaacctttatggcttcctccaatgggcatcgaaa
cggcaaactgttcccagggtcagcgcattctgcgagttactctgctccatctccgtaggc
gaggacaatgccactgcagcccatcggttcttgtctgaagaggacaagttcatgtctgcg
aaattcaaacgatccacgtccatgaactggtcgcagatgttcgctgagcttcaactttat
gcaacgagagttactgaaaagccgtctacttcgcaggcgatcctgcgatcaaggaaactc
gacccagctgatatgagcgagccggagagtccagttatgttgacatgctacctgaggcta
ctagagcatctgagtaagcagagtgctacgatacgagactggctgcttcaccaccctacg
tttaatgtcgttggcacgttgttgacactctgcagtgggcccattcctacgcatctgcga
gcaaacgtctttgcagcgcttgcggccctgatgacagatagaacttctcacaatgggaac
gaaatgtggctttctattgaccagtggatttccgggggttctatgagtgcttccaaccta
gggaaagtcccggtcgtttccaacccgcttgtgtggcatgaacaacaggccttccaaagg
attggcgagagtttcgatcaagccaatgccttcgttcgtctcgtttattcactcatctcc
cctgccctcgattcagctgattttcacctctccttgccgtttcccgagagcctgggttcg
tcctaccggatgccaggcattgaaccttacatagactttgtcatgggtcaggctctgtcc
aggaaaattccggatctgaacgaacggcagacccgcttcttgacttacaactgcttggat
ttcatcgtgacatgtctgcagtctttcaacgaaagcctggtttccgttctcagccagcct
acggtatccactgatagtatcgtcaagcaatctacattcgtcacctacattcgtctccat
ccttttgcacgggtcacggagtggcttttcaatgaggatgtgatcaaagctatctttgct
acagcccatcaagatgttaatgaggttgcaaaagcttcgtcggactccgtcctcgtccag
tccttggtccggagcttggaagtcatggacatgatgatcgaccttcaatcgacgtacttt
aatattgtgaggccggcgatcaaggcccagaccggcacgagcagaacaaatgtggcgaac
tctgcgctgtcagcttttgaggatagcattctcaacaacttgtctattatccctgcgttg
tgcctttactgcagcacggggcatcagcagctcaccgtcacgtctatggcattgctggag
aagctatccagctcgagaaagctgaataagatcacgtcaccagagttgtccaagtggcgt
tcaccgaacaagatcgtcgaagttctgagtgctgaggtagatctcaacagtgtgtcacgt
ccacttgtgtcccagatgcaacccgagtcgagagagatagaagctggcccacaatctccg
gggtacattatcagggaaagcctcctggcacttctcaacagctgtctcagcacgattaat
gaccgacccacgatagctcacctgctccttgggtttaacagcatcggaaacatacttgat
atcgctcccgacagcctgtttgctgataagatgtcactgctccatgctgtcatcggattc
ttgcagaactaccctgacgcgctggatggcaatattctcccatggctggtgcatgtcaag
cgcatggcctttggagtcctgaaacacctttggtcttctaagctttcttcctacttcaca
ctcgccgagatgcgtggcagccgctttcttctcagtatgttcgcgtgtcagccgatcata
gggccaaacacaccctgggatggatttctaatcggcacgcctgagttctggctttctgaa
tcaacggctggtcttgcggaatttcttctttacagaagctatttgttcgagtacgccgcg
actgaaattcgctcggctacaaagctcgggtctccaactcttcaagctgaaataatttca
actctatttggaaactctgtttcggaaactggggagaccattgtgaatccttccgtcttc
gacctgttcgatttcgcggacctggacactcaacatcagttacaaccaccggccctaagc
ttccttgatggtattgaatttgacgcgtgtgcaagaccggaaacggacagttctccaatt
gtctacaacttggacgagatagtagaacttgttcaggtcagaaaggaagaattgtcattg
agtggacatctacgacctcaggacgaagagctattccaggccgagtccgaaagtttgata
ttattcatacggtccacaaaccaagcaagccagatcgcgttcaatcgttatttggcccta
cggtcctggacacagctcatcaccacgatgctcacttgctctgaaatcgatggcggaagg
agagctaccttcatcctgcattcgctccagttgatcctccccaagctagaaattgctatt
gaggaagacctaccggaaggcttagaattggcacgactggccgagaccttggttagtaga
ctggaatctacgaagcctggttctggtaatccccgcaggagtggcgacgttcttgacgaa
aagcttcatcaattatttcaggtctgcgtgagaggtgtaaccttagcaaacggaaatgtg
agcatcagggagaccttttacaacacttgcgcacactatgtcgctggtatcatctcaaca
gagcccgttcatcagagtatgaagttccagagccagcaagtaatcaaagctgcaggccat
gccctgattgaggccgtctgcgatgatgcgtatgctggccaggagacatgccgagtatct
gcccttttgctcctcaatctattggctgctctggataggcaagcggatggattgttggcc
gattctatatcccagtccaactatttgagcctcttcttggacaccatcaggtcgctacct
atcgaattgagaaacgcccaggccagtgatactcctttgctgttgtcctactaccagtcg
ctcttgtctcttcttcaggagctttgccagaccaagaatggtgcgacgtatgtcctgaaa
actggcctgttccaggcagtgcgggactcgcagctattcgcagccgacccagatctcggc
atcgatattgataacccggatgctcttcgaaagtactatgacctgcttgactcggtcctc
cgagtggttgtcgccgccgttttctcccgagggctgcacaacgagcagatgctggagcaa
actcgagtcttccttgccgagaatagacaaagcatggttggcattttcaagagatttgcc
aaacttggcggtgcgggtgccgcagatcaccatgatgcactgcggaaactcactaagtca
tacctggcacttatcacggccacggattttctggataactcgagaggcaccaccgagcag
aggagcggtaagcgcaagtctatcgggaagaggaagctctctgatcaagaggaggcattg
caacaaccccagcagcagcaagcgaacatttcggaattcctgtctcggaaccatacaacc
cccgccagaggtcatcaccaacagacgtccccgacgagcaagcgtctacgactatcgcca
ccctcatcggactctgtcccttcggcttactcgcgagatcgcagcgcatccgacaggatg
tacaatttcgcaaatgcagagtccaggcctggcgcgccgatgggacagagtgcgagcggg
gccgatcttcctaatacaaccactaaacctcgcacctttaacgcaacgtcgcgccaaaac
aatttcactccccacactggagcaaagcggttggtcgtgaagaatctccgcacgggatca
cggttgaaccaggagtcgtactttgagaagatttggggccaacttgatgctgcgctgtcg
gcgatctttggtggtggaaagcccgaagtttcgctcgaagagctttacaagggtgccgaa
aatgtatgtcgccaaggtcgagctgcagttctagccaaacggctccaggatcggtgtcga
gaacatgtatctgggagattacgcgataaattggtggcaaaggctgcagatgggagcaac
gtcgatacactgcgagcggtggtagaagcatggtcgcagtggcagtcaaagctggtaacc
gtgcgctggatcttctactatctcgaccagtcattcctcctccattccaaagagtttccc
atgatacgtgagatgggcttaattcaattccggcagcacatattttccgatgccgtatta
cagccgaagatcctacagggcgcttgtgaccttgtcgaggcggaccgtggcgaagaacaa
agcgtggtggctgactcgttattacttcgaaatacaattgaactgttccacggccttgac
atctatacaactggctttgaaccgcttctcatatcggaatccaagaaatacttttcttca
tgggcccagcgagaagcaacagggtacttggctacttttgccgagaacagccaccgtata
attgagcgggaagtgactcgatgtgagctgttttcgctgaatagaagcaccaagcagatg
ttatcagagctgctggaccgcgccttggtaacagaacaagaaaatgttttgctcaaccag
cccgatatactaggtctactacgtgcggggaacaaggttgctttagaaaggctttactca
ctccttcaacggaaggatctcggtgcgaagttgaaggccgcttttagtggttatattatt
gaggagggctctgggatcgtctttgacgaggataaagaagcagacatggtggctcatcta
ttagaattcaagcagcaacttgacgatatttgggtcaattctttccatcgaaatgaggag
ttgggccatacactccgcgaagctttcgagacgttcatcaacaaaggaagaaagtcagaa
tctactggaggtaccgacaaccccaagactggagagatgattgccaagtacgtggacagg
ctcctcaagggtgggtggaagcttgcacctgcgcgcaaggcggaggacatgccacttgcc
gatgaagacgccgaaatcgacagacaactggatcaggtcctggacctgttccgttttgtc
catggaaaagcagtcttcgaagccttctacaagaatgatcttgctcgtcggttgctgatg
ggcaggagcgccagcgacgatgcggaaaagagtatgctggcaaggctcaagacagaatgt
gggtcaagtttcacacataacctggagtccatgttcaaagatatggatgttgcccgcgat
gagatgtcggcatacagctcaatacagcgcgaacggcgggaccgtctaccggtggatttg
aacgtcagcgtgctttcggcatcagcatggccaacataccccgatgttcaggtgcggata
ccgcccgaaattgcgactgccgtcgacgatttcgaaaagttctacaacaccaaatacaac
gggcgcaagctcaattggaagcaccaattggcacattgtcagctgcgcgcaaggtttccc
aagggagataaggaattggtggtcagctccttccaggcgattgtgctgttgctcttcaac
gatatcccggagggtggaagcctcgggtatgcacagatacaggaggcgaccatgttatct
gatcaagaactgaaacgaacgctgcaatcgctcgcatgtgcgaaataccgtgttctaagc
aagaagccgaagggccgggatgtgaatacgacagacgagttttcatacaacgcggcattc
accgacccgaagatgcgaattaaaatcaaccaaattcaactgaaagagacgaaggaagag
aacaagaccacgcatgagcgggtggctgccgatcgtcactatgagactcaggcagcgatt
gtgcgaatcatgaagagccgcaagacgatcacgcacgctgagcttgtagctgaggttatc
aaggcaacccgaagtcggggagtgctagagccggcggatattaagaagaatattgagaaa
ctgattgagaaagactacatggagcgcgaggaagggaaccggtatcaatatgtggcttag

DBGET integrated database retrieval system