KEGG   Aspergillus niger: ANI_1_908094Help
Entry
ANI_1_908094      CDS       T01030                                 

Gene name
An11g06820
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ang  Aspergillus niger
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ANI_1_908094 (An11g06820)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ANI_1_908094 (An11g06820)
Transfer RNA biogenesis [BR:ang03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ANI_1_908094 (An11g06820)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 417 aa AA seqDB search
MGLWSTNSADPCSIRRPRTISIFSRLVLCSTLLLGVSFILKTRPHLLPSFPHLTPSRSSY
TQPTTMSYQQERYIAELAVQRATLLTQKVFNEKAKGTVSKDDKSPVTIGDFGAQALIIQA
IRKNFPNDEIVAEEEASSLREDKALSAEIWRLVQDIKLVDTESDNLLGGPLPSEEAMLDI
IDQGKSAGGAKGRIWALDPIDGTKGFLRGGQYAVCLGLIEDGDVKVGAIGCPNLPVNDAE
TMSAGIGAEQTSGTGKGVLFSAIQGVGSISRPLTNGALAESKSISMRPVPDIAQAVFCEG
VEAGHSAQDDNAAVAKLLGITSPSVRLDSQAKYCSIARGAGDIYLRLPVKKDYQEKIWDH
AAGDLIVREAGGQVTDIYGQRLDFSKGRTLAANKGVVAAPKALQDQVIGAVKTVLKL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggtctctggtcgacgaattcggcagatccttgctccattcgcaggccgcgtactatc
tccatcttctcccgtctggtcctctgctccactctgctactgggtgtcagcttcatctta
aaaacccgccctcatctgctcccatctttcccccacctaaccccctcccgctcctcctat
acccaacccaccaccatgtcctaccagcaggaacgctacatcgccgagctcgccgtccag
cgtgccaccctcctcacccagaaggtcttcaacgagaaggccaagggcactgtctccaaa
gatgacaagtcacccgttaccattggcgacttcggcgcccaggctctgatcatccaagcc
atccgcaagaacttccccaatgatgagatcgtcgccgaagaggaggccagcagccttcgg
gaggacaaggcgctgagcgccgagatctggagactggtccaggatatcaagttggtggac
actgagagcgacaacctcctgggaggccctctgcctagcgaagaagcgatgctggacatc
atcgaccagggcaagagtgctggcggtgccaagggtcgtatctgggctttggaccccatt
gacggcaccaagggtttcctgcgcggtggtcagtacgccgtctgtctcggtctgattgaa
gacggtgatgtcaaggttggtgccattggctgccctaacttgcctgttaacgacgccgag
accatgtctgcgggcatcggcgctgagcagaccagtggcactggcaagggtgtcctcttc
tccgccatccagggcgttggttccatcagccggcccctcaccaacggtgctcttgctgag
agcaagtccatctccatgcgccccgtccccgatatcgctcaggccgtgttctgcgagggt
gtcgaggccggtcactccgctcaggacgacaacgccgccgttgctaaacttctcggtatt
acctcccccagtgtgcgtctggactcgcaagccaagtactgctcgattgcccgcggtgct
ggtgacatctacttgcgcctgccggtgaagaaggactaccaggagaagatctgggaccac
gccgctggtgacctgatcgtgcgggaagctggtggtcaagtgacggatatctacggccag
agactggatttcagcaagggcaggaccctggcggccaacaagggagttgtcgcggccccc
aaggccctccaggaccaggtcatcggtgctgtgaagactgttctgaagttgtaa

DBGET integrated database retrieval system