KEGG   Aspergillus niger: ANI_1_916144Help
Entry
ANI_1_916144      CDS       T01030                                 

Gene name
An16g06800
Definition
endoglucanase A
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ang  Aspergillus niger
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANI_1_916144 (An16g06800)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ANI_1_916144 (An16g06800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 517 aa AA seqDB search
MRISNLIVAASAASMVSALPSRQMKKRDSGFKWVGTSESGAEFGSALPGTLGTDYTWPET
SKIQVLRNKGMNIFRIPFLMERLTPDGLTSSFASTYLSDLKSTVEFVTNSGAYAVLDPHN
YGRFDGSIITSTSDFKTWWKNVATEFADNDKVIFDTNNEYHDMEQSLVLDLNQAAINGIR
AAGATTQYIFVEGNAYTGAWDWTTYNDNLSGLTDSEDKIIYEMHQYLDSDSSGTSETCVS
STIGQERLEKATEWLKTNNKQGIVGEFAGGVNSVCEEAVEGMLAYMSENSDVWVGASWWS
AGPWWGTYMYSLEPTDGTAYSTYLPILEKYFPSGDASASSSASVSVAAATSTASTTTAAF
EQTTTPATQVEIASSSSSSSANAASQTTLSKVKSKSKSPCKLSSATSSAVAATTPVVVAT
TPAVAPTSSSVAFVTTSVYVPTTTAAVAPSQVSSSAAASSSGVVGVSDPQGPSATNSAGE
VNQYYQCGGINWTGPTVCASPYTCKVQNDYYYQCVAE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgagaattagcaacttgatcgttgcggcttctgccgccagcatggtgtccgctctcccc
agccgccagatgaagaagcgtgactctggcttcaagtgggttggtactagtgaatccggc
gctgaattcggctccgccctccccggcaccctgggaaccgactacacctggcccgagacc
tccaagatccaggtcctgagaaacaagggcatgaacatcttccgtattcccttcctcatg
gagcgtttgactcccgatggcttgaccagctctttcgcttcgacttacctctctgacctg
aagtcgactgtcgaattcgttaccaacagcggtgcctacgctgtccttgacccccacaac
tacggacgttttgatggaagcatcattacttccacctccgacttcaagacctggtggaag
aacgtcgctaccgaatttgccgacaacgacaaggtcatcttcgataccaacaacgagtac
catgacatggagcagtccctggttctggacctcaaccaggctgctatcaacggtatccgt
gccgctggtgccaccacccagtacatcttcgtcgagggtaacgcctacaccggtgcctgg
gactggactacctacaacgacaacctgtctggcctgaccgacagcgaggacaagatcatc
tatgagatgcaccagtaccttgactccgacagctccggtacttccgagacctgtgtcagc
tccacgatcggccaggagcgcctcgagaaggccaccgagtggctgaagaccaacaacaag
cagggtatcgtcggtgaattcgccggtggcgtcaactccgtgtgtgaggaggctgtcgag
ggtatgctcgcgtacatgtccgagaactccgacgtctgggttggtgcttcctggtggtct
gccggtccctggtggggaacctacatgtactctctggagcctaccgatggcaccgcctac
tccacctacctgcccatcctcgagaagtacttccctagcggtgatgcttccgcctccagc
tcggcctctgtctccgttgctgctgctacctccactgcttccaccaccactgccgctttt
gagcagaccaccacccccgccacccaggttgagattgcctcttcctcttcttcctcttcg
gccaacgccgccagccagactactctcagcaaggtcaagtccaagtccaagtccccttgc
aagctgtccagcgccacctccagcgctgtcgctgccaccacccctgttgttgttgccacc
acccctgccgtcgcccctacttcttccagcgtcgctttcgttaccacttccgtttacgtt
cccaccaccactgctgccgttgcccccagccaggttagctccagcgctgctgctagcagc
agcggtgtcgtcggtgtcagcgacccacagggtccctcggctaccaactctgctggtgag
gtgaaccagtactaccagtgcggtggtatcaactggaccggccctaccgtctgtgccagc
ccctacacctgcaaggtccagaacgactactactaccagtgcgttgctgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system