KEGG   Aspergillus niger: ANI_1_924184Help
Entry
ANI_1_924184      CDS       T01030                                 

Gene name
An04g05620
Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ang  Aspergillus niger
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANI_1_924184 (An04g05620)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANI_1_924184 (An04g05620)
   00620 Pyruvate metabolism
    ANI_1_924184 (An04g05620)
   00640 Propanoate metabolism
    ANI_1_924184 (An04g05620)
  Energy metabolism
   00680 Methane metabolism
    ANI_1_924184 (An04g05620)
Enzymes [BR:ang01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ANI_1_924184 (An04g05620)
Lipid biosynthesis proteins [BR:ang01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ANI_1_924184 (An04g05620)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 670 aa AA seqDB search
MADGSVMPPKSSVVVEAHEVDTFHVPEAFHQKHPTGTHLKDLDEYKKLYEESIRSPDTFW
ARMARELLHFDQDFQTTHSGSLENGDNAWFVEGRLNASYNCVDRHAFKNPDKVAIIYEAD
EPSEGRTITYGELLREVSRVAWVLRQQGVKKGDTVAIYLPMIPEAIVAFLACSRIGAVHS
VVFAGFSSDSLRDRVLDAGSKVVITTDEGKRGGKVIGTKRIVDEALKQCPDVTSVLVYKR
TGAEVPWTKGRDVWWHEEVEKYPNYLAPEPVNSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRYFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPNFSRY
WDVIEKHKVTQFYVAPTALRLLKRAGDEHIHHKMAHLRVLGSVGEPIAAEVWKWYFEVVG
KEEAHICDTYWQTETGSNVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEITGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHHMVAEAAVVGIADELTGQAVNAFVALKEGNETSDQVRKDLIM
QVRRSIGPFAAPKAVYVVEDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVDKI
IATVHAARGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggccgacggcagtgttatgccccccaagtcctccgtggtggtcgaggcccacgaagtc
gacaccttccatgtccccgaagcattccaccagaagcacccgacaggtacccacttgaaa
gaccttgacgagtacaagaagctctatgaggagtccatccgcagcccagacactttttgg
gctcgcatggcccgcgaacttcttcacttcgaccaagacttccagaccacccacagtggg
tcgctggagaatggcgacaatgcctggtttgtcgagggtcgtctgaacgcctcctacaac
tgcgtcgatcgccatgccttcaagaaccccgacaaggtcgccattatctacgaggccgat
gagcccagcgagggccgcacaatcacctacggtgagctcctgcgcgaggtgtctcgtgtg
gcctgggttctccgccagcagggtgtgaagaagggtgacaccgttgctatctaccttccc
atgattccggaggccattgtcgctttcttggcttgctctcgtatcggtgccgtccactcc
gttgttttcgccggtttctcgtccgactctctccgggaccgtgtcctggacgctggctcc
aaggtcgtcatcacgaccgatgagggcaagcgtggaggaaaggtcattggcaccaagcgc
attgtcgatgaagccctgaagcagtgccccgatgtcactagcgtcctggtctacaagcgc
accggcgcggaggtcccctggaccaagggccgtgatgtctggtggcacgaggaggtcgag
aagtaccccaactaccttgctcctgagccggtgaactcggaagatcccctcttcctgctc
tacacctctggttctaccggaaagcccaagggtgtcatgcacaccacggctggttacctt
ttgggtgctgccatgaccggcaagtatgtctttgatatccacgacgatgaccgctacttc
tgtggtggtgatgttggctggatcaccggccacacgtacgtcgtatatgcacccttgctg
ctcggatgctctaccgtggtcttcgagagtaccccggcttaccccaacttctcccgttac
tgggacgtgatcgagaagcacaaggtgacccaattctacgtcgcccccactgccctgcga
cttctgaagcgggctggcgacgagcacattcaccacaagatggcacacctgcgtgtcctg
ggctctgtcggtgagcctattgctgccgaggtctggaaatggtacttcgaggtggtcgga
aaggaagaagcccacatctgcgatacctactggcagactgagacgggttcgaatgtcatc
actcccctgggtggtattaccccgacgaaacccggaagcgcgtcgcttcccttctttggc
attgagcccgccatcattgacccggtctctggtgaggagatcactggcaacgatgtggag
ggtgtgcttgccttcaagcaaccctggccgagcatggcccgtaccgtgtggggcgcccac
aagcgctacatggatacctacttgaacgtttacaagggctactacttcactggagatggt
gcaggccgcgatcacgacggatactactggatccggggtcgtgttgacgatgtggtcaac
gtttccggacaccgtctgtccacggctgagattgaagccgccctcattgagcaccacatg
gtggctgaggctgctgtcgtcggtattgccgacgagcttaccggtcaggccgtcaacgca
ttcgtggccctgaaagagggcaacgagaccagcgaccaggtccgcaaggatctgatcatg
caggttcgtcggtccatcggacctttcgctgcccccaaggccgtctacgttgtcgaggat
ctccccaagacccgtagcggtaagatcatgcgccgtattctccggaagatcctgagcggc
gaggaggacagcctgggtgacacttctactctgtcggacccttcggttgttgacaagatc
attgccacggtgcacgctgcccgtggcaaataa

DBGET integrated database retrieval system