KEGG   Aspergillus niger: ANI_1_924184Help
Entry
ANI_1_924184      CDS       T01030                                 

Gene name
An04g05620
Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ang  Aspergillus niger
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ang01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ang00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ang00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ang00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ang00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 670 aa AA seqDB search
MADGSVMPPKSSVVVEAHEVDTFHVPEAFHQKHPTGTHLKDLDEYKKLYEESIRSPDTFW
ARMARELLHFDQDFQTTHSGSLENGDNAWFVEGRLNASYNCVDRHAFKNPDKVAIIYEAD
EPSEGRTITYGELLREVSRVAWVLRQQGVKKGDTVAIYLPMIPEAIVAFLACSRIGAVHS
VVFAGFSSDSLRDRVLDAGSKVVITTDEGKRGGKVIGTKRIVDEALKQCPDVTSVLVYKR
TGAEVPWTKGRDVWWHEEVEKYPNYLAPEPVNSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRYFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPNFSRY
WDVIEKHKVTQFYVAPTALRLLKRAGDEHIHHKMAHLRVLGSVGEPIAAEVWKWYFEVVG
KEEAHICDTYWQTETGSNVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEITGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHHMVAEAAVVGIADELTGQAVNAFVALKEGNETSDQVRKDLIM
QVRRSIGPFAAPKAVYVVEDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVDKI
IATVHAARGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggccgacggcagtgttatgccccccaagtcctccgtggtggtcgaggcccacgaagtc
gacaccttccatgtccccgaagcattccaccagaagcacccgacaggtacccacttgaaa
gaccttgacgagtacaagaagctctatgaggagtccatccgcagcccagacactttttgg
gctcgcatggcccgcgaacttcttcacttcgaccaagacttccagaccacccacagtggg
tcgctggagaatggcgacaatgcctggtttgtcgagggtcgtctgaacgcctcctacaac
tgcgtcgatcgccatgccttcaagaaccccgacaaggtcgccattatctacgaggccgat
gagcccagcgagggccgcacaatcacctacggtgagctcctgcgcgaggtgtctcgtgtg
gcctgggttctccgccagcagggtgtgaagaagggtgacaccgttgctatctaccttccc
atgattccggaggccattgtcgctttcttggcttgctctcgtatcggtgccgtccactcc
gttgttttcgccggtttctcgtccgactctctccgggaccgtgtcctggacgctggctcc
aaggtcgtcatcacgaccgatgagggcaagcgtggaggaaaggtcattggcaccaagcgc
attgtcgatgaagccctgaagcagtgccccgatgtcactagcgtcctggtctacaagcgc
accggcgcggaggtcccctggaccaagggccgtgatgtctggtggcacgaggaggtcgag
aagtaccccaactaccttgctcctgagccggtgaactcggaagatcccctcttcctgctc
tacacctctggttctaccggaaagcccaagggtgtcatgcacaccacggctggttacctt
ttgggtgctgccatgaccggcaagtatgtctttgatatccacgacgatgaccgctacttc
tgtggtggtgatgttggctggatcaccggccacacgtacgtcgtatatgcacccttgctg
ctcggatgctctaccgtggtcttcgagagtaccccggcttaccccaacttctcccgttac
tgggacgtgatcgagaagcacaaggtgacccaattctacgtcgcccccactgccctgcga
cttctgaagcgggctggcgacgagcacattcaccacaagatggcacacctgcgtgtcctg
ggctctgtcggtgagcctattgctgccgaggtctggaaatggtacttcgaggtggtcgga
aaggaagaagcccacatctgcgatacctactggcagactgagacgggttcgaatgtcatc
actcccctgggtggtattaccccgacgaaacccggaagcgcgtcgcttcccttctttggc
attgagcccgccatcattgacccggtctctggtgaggagatcactggcaacgatgtggag
ggtgtgcttgccttcaagcaaccctggccgagcatggcccgtaccgtgtggggcgcccac
aagcgctacatggatacctacttgaacgtttacaagggctactacttcactggagatggt
gcaggccgcgatcacgacggatactactggatccggggtcgtgttgacgatgtggtcaac
gtttccggacaccgtctgtccacggctgagattgaagccgccctcattgagcaccacatg
gtggctgaggctgctgtcgtcggtattgccgacgagcttaccggtcaggccgtcaacgca
ttcgtggccctgaaagagggcaacgagaccagcgaccaggtccgcaaggatctgatcatg
caggttcgtcggtccatcggacctttcgctgcccccaaggccgtctacgttgtcgaggat
ctccccaagacccgtagcggtaagatcatgcgccgtattctccggaagatcctgagcggc
gaggaggacagcctgggtgacacttctactctgtcggacccttcggttgttgacaagatc
attgccacggtgcacgctgcccgtggcaaataa

DBGET integrated database retrieval system