KEGG   Aspergillus niger: ANI_1_932064Help
Entry
ANI_1_932064      CDS       T01030                                 

Gene name
An07g07520
Definition
repressible alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ang  Aspergillus niger
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ANI_1_932064 (An07g07520)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ANI_1_932064 (An07g07520)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANI_1_932064 (An07g07520)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 595 aa AA seqDB search
MAREEPLLASRPSSDHSSIRNAEEEDALLTGIRTDRDRRRRWSFWKELGLFTWALIATVA
VIVLSVVYQHESSRGPDRSKDPWTKPTGKRNLIFMVSDGMGPASLSMTRSYKQLTQGLPA
DEVLILDKHFVGTSRTRSSSSLVTDSAAGATAFSCGHKSYNGAISVLPDHSPCGTVLEAA
SLAGYKTGLVVTTRITDATPACFASHVNLRQYEDRIAEQEIGEHPLGRVVDLIMGGGRCH
FLPNSTDGSCRGDDRDLVELAKEGGYHYMDDRAGFDSLNGGTEGKLPLLGLFAEKDIPFE
IDRRSQNDVYPSLEEMARTALTILSQATADSEQGFFLMIEGSRIDHAGHGNDPAAQVNEV
LAYDKAFAAVLEFLEQDSTPGVVVSTSDHETGGLSVARQLQPEYPDYKWLPGVLANASHS
SEYVNKKLVNYLATETDDKKQYKFVRSLIENDLGITDVTDEEINAVLDPNYPYNPQYVFA
DIVSRRAQIGWATHGHSGVDVNIYASGKLAFPLAGNHENTEVGSFLADFLDLDLKSTTKK
LLSSDYWTMSSEDSPYGWLGDPLGEDVRTEGLDTYHGEFRKRGLSERGCSCGESH
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgaagagcctctcttggcctcacgcccctcgtccgaccattcctccattcgg
aatgccgaggaggaggacgccctgctaaccgggatccgcaccgaccgtgaccgacgccgc
agatggagcttctggaaagagctcggcctcttcacctgggccctcattgctacggtagct
gtcatcgttctctccgtcgtttaccaacatgaatctagtcggggcccagatcgctcgaaa
gatccctggacgaagccgactggcaaacggaaccttatcttcatggtgtccgacggcatg
ggccccgctagtctgtccatgaccaggagctacaaacaactcacacaagggcttcccgct
gacgaggtcctcatcctggacaagcactttgtcggaacctcccgtacacgatcgagctcc
agccttgtgacggattccgcggccggtgcgacggcattctcgtgtggtcataagagctac
aacggcgccatctccgtgcttcctgaccattcgccttgtggcaccgtccttgaggctgcc
tccttggctggttacaagacggggctggtagtgacgactcgtatcaccgatgcgactccg
gcttgctttgcttcacatgtgaatctccgacagtacgaagaccggattgcggaacaggaa
atcggggagcacccgctgggccgtgtggtggatcttatcatgggtggaggccggtgtcac
ttcttgcccaactcgactgacggaagctgtcggggcgatgaccgcgaccttgtcgagctg
gcgaaggagggtggataccattacatggatgatcgagccgggttcgactctttgaatgga
gggactgaaggcaaactgccactcctggggctctttgcggagaaagacattcccttcgag
atcgaccgccgcagccagaatgacgtgtacccctctcttgaggagatggcccgtaccgcc
ttgacgatactcagccaggccaccgccgacagtgagcagggtttcttcctcatgattgag
ggttcgcgcatcgaccatgctggccatggaaacgacccggctgcacaggtcaatgaagtt
ttggcatatgacaaggcctttgcggccgtgctggagttcctagagcaggactcgactccg
ggcgtggtcgtgagcacatccgaccatgagactggaggcttgtcagtcgcgcgtcagcta
cagcctgaataccccgactacaaatggcttcccggtgtcctggccaatgccagtcactct
tcggagtacgtcaacaagaagctagtgaactatctcgccactgaaacggacgacaagaag
cagtacaagttcgtccgcagcctcattgagaacgatcttggcatcacagatgtcacggac
gaggagattaacgccgttctcgaccccaattacccatataacccccagtacgtctttgcg
gatattgtcagccgcagggctcagattggttgggcgacccacggacattccggtgtcgat
gtcaacatctacgcctccgggaaactcgcgtttcccctagcaggcaaccacgagaacacc
gaagtcggctccttcttggccgacttcctagacctggacctcaagagcacgaccaaaaag
cttctctcatcggactactggaccatgtcttccgaggatagcccctatggctggctcggc
gaccctctaggcgaggatgtccgaaccgaaggcctagacacctaccacggcgagttccgc
aagcgcggactctccgagcgaggctgcagctgtggcgagagccactga

DBGET integrated database retrieval system