KEGG   Aspergillus niger: ANI_1_954034Help
Entry
ANI_1_954034      CDS       T01030                                 

Gene name
An03g00500
Definition
(RefSeq) glucan endo-1,6- -glucosidase BGN16.3
  KO
K22276  
glucan endo-1,6-beta-glucosidase [EC:3.2.1.75]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.75  glucan endo-1,6-beta-glucosidase
     ANI_1_954034 (An03g00500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 491 aa AA seqDB search
MSWMLWYTIAGLASLGHASLEKRATDASAYCSDSSGTYKLSSITAPVQGSGSPGSASTWK
LSIDDTSSGHKQAITGFGAAVTDATVTSFNTLSSSTLQQLLNELMTSDGANFSLMRHTIG
ASDLSGDPVYTYDDNGNEADPSLSGFGLGDRGTAMAEMLATMKSLQSDLKVLGSPWSAPG
WMKLNGVIDGNATDNNLNDGYLTSGGTGSTGYSSAFAQYFVKYIQAYEALGATVDAITIQ
NEPLNSQSGYPTMYVYDYESAQLIQKYIGPALADAGLSTEIWAFDHNTDHASYPQTVLDE
ASQYVDTVAWHCYAKDVDWTVLSQFYSANPGVKQYMTECWTPASGSWHQAADFTMGPLQN
YASGVMAWTLGTNTDDGPHLTSGGCDACQGLVTINDDDSYTLNTAYYMMAQFSKFMPPGA
TVLNGTGSYTYSGGDGVQSVASLNPDGTRTVIIENIFSNDIYLTLSTESGEEWSGNIPSE
SVTTWVLPALS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagttggatgttgtggtatactatagctggcctagcatctctaggccatgcttctctt
gagaaacgcgccaccgatgcatctgcgtactgctccgattcatcgggtacctacaagctc
tcgtcgatcacggccccagttcagggaagtggcagcccgggctcagcatccacctggaag
ctaagtattgacgatacatcatccggtcacaagcaggcaatcactggcttcggggctgct
gtgaccgatgcgaccgtcacgtcttttaacaccttgtcgagctctaccctccaacagctc
ctcaatgagttgatgacttccgatggagctaatttctctctcatgcgccataccatcggc
gcgtctgatctgtccggtgatccggtctacacctatgatgacaacggaaacgaagcagac
ccctcactttccggcttcggtctcggcgaccgtggcactgctatggcggaaatgttggcc
acgatgaaatcgttgcagtcagacctgaaggtgcttgggtccccgtggagtgcgcccgga
tggatgaaattgaatggcgtgattgatggcaacgcgactgataacaaccttaacgatggc
taccttaccagtggtggcacgggaagcaccggctactccagtgctttcgcgcagtacttc
gtgaaatacatccaagcgtacgaagcattaggagctacggtcgatgccattacgattcag
aatgagccgttaaatagtcaatctggatatcccaccatgtatgtttacgactatgagtct
gcgcagctgatccaaaaatacattggaccggctcttgccgacgctggactgagcacggaa
atctgggccttcgatcacaatactgatcacgcatcgtaccctcagactgtgcttgatgaa
gcaagtcaatacgtcgacacggtagcctggcactgttatgcaaaggatgttgactggact
gttctcagccagttctacagcgccaaccctggggtcaagcaatatatgaccgaatgctgg
acaccagcttccggatcatggcaccaggctgctgattttaccatgggccctctgcagaac
tatgcgtcgggggtcatggcgtggactctgggcacgaacactgacgacggtccgcatttg
accagtggtggatgcgacgcctgtcagggcttggtcaccatcaacgatgatgacagctat
actcttaatactgcctactacatgatggcacagtttagcaagttcatgcctcctggcgcg
accgtgttgaacggaacggggagctatacctactcgggtggcgatggcgtacagtcggtg
gcgtccctgaaccctgatggaacgcgcacagtcattattgagaatatattcagtaacgat
atttacttgactctgtcgacggagagcggagaggagtggagtggaaatatccccagtgaa
tcggtgactacttgggtccttccggccttgtcttga

DBGET integrated database retrieval system