KEGG   Aspergillus niger: ANI_1_998024Help
Entry
ANI_1_998024      CDS       T01030                                 

Gene name
An02g07250
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ang  Aspergillus niger
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANI_1_998024 (An02g07250)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ANI_1_998024 (An02g07250)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ANI_1_998024 (An02g07250)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MTSPSTIRQRFLSKPNQLGVVAVGFNGGQCKMGVEAAPMALVQAGLLEQLRDDLGYELHY
DEKVHHYEDKMPESDPDHRGMKKPRSVSAVTESLSAQVYEHAKEGKFVLTLGGDHSIAIG
TISGTAKAIRERLGREMAVIWVDAHADINVPEMSPSGNIHGMPMAFLTRLAREEQKDIFG
WLQDEHIINTRKLVYIGLRDVDRGEKQLLREHGIKAFSMHDVDRYGIGRVVEMALAHIGN
DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLVAMDLVEVNPSLE
EHGASDTIRTGCSIVRSALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacttctccttcgacaattcggcagagattcctctccaagcccaaccagctgggcgtc
gtggccgttggtttcaatggcgggcagtgcaagatgggcgtcgaagcagccccgatggct
ctcgttcaagccggtctgctcgagcaactgcgcgacgatctgggctacgaactgcactat
gacgaaaaggtccaccactacgaagacaagatgcccgagtccgaccccgaccaccgcggc
atgaagaagccccggtcggtcagcgccgttaccgagtcactgagcgcccaggtctacgag
cacgccaaggagggcaagttcgtgctgaccctgggtggtgaccactccatcgctatcggt
accatctccggcacggccaaggctattcgtgagcgactgggccgtgaaatggctgttatc
tgggtggatgcgcacgctgatatcaacgtccctgagatgagccctagtggtaacatccac
ggtatgcccatggcgttcttgacgcgcttggctcgtgaggaacaaaaggatatcttcggc
tggctgcaggatgagcatattatcaacacccgcaagctggtatacatcggtcttcgggat
gtggatcgcggtgagaagcagttgcttcgtgagcatggcattaaggcgtttagcatgcat
gatgttgatcggtacggcattggccgcgtggtcgaaatggccctggcgcacattggcaat
gacacgccgatccacctgtcgttcgacgtcgacgcgctggacccgcagtgggcgcctagc
acgggtacccctgtgcgtggtggactgacgctgcgcgaaggtgacttcatctgcgagtgt
gtgcacgagacgggcaacctggtggcgatggatttggtggaggtgaaccccagcctggag
gagcatggagctagcgacactattcggacgggatgttcgattgtgcggagtgccttggga
gatactctgctgtag

DBGET integrated database retrieval system