KEGG   Aspergillus nidulans: AN0075.2Help
Entry
AN0075.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ani  Aspergillus nidulans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AN0075.2
Enzymes [BR:ani01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AN0075.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 368 aa AA seqDB search
MVRASTLLLSGLVTLATARSAVLDLIPKNFDKVVLNSGKPALVEFFAPWCGHCKNLAPVY
EELGQAFAHAEDKVSIAKVDADANRDLGKRFGIQGFPTIKWFDGKSETPEDYKGGRDLES
LTAFVTEKTGIKAKGAKKEPSNVEMLTDTTFKSVVGGDKDVFVAFTAPWCGHCKKLAPTW
ETLATDFALEPNVIIAKVDAEAESSKATARSQGVTGYPTIKFFPKGSTEGIVYQGARTEE
AFVDFVNNNAGTHRAPGGTLNEKAGTILALDEIVAKYITSKNFGELVDEAKKVAKTVGGK
YAEYYVKVAEKLAQNEEYAAKELERLKKVLSKGGSAPEKLDDMVSRSNVLRKFLEVEEKV
EDVVKDEL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcgccagcactctcctgctgagcggcttggtgactctcgccaccgctcgctct
gcagtcctcgacctgattcccaagaactttgacaaggtcgtcttgaactccggcaagccg
gccctcgtcgaatttttcgccccctggtgtggtcactgcaagaatctcgccccggtttat
gaggaactgggccaagccttcgcgcacgccgaagacaaggtcagcattgcgaaggttgat
gctgatgcgaaccgcgatctcggcaagaggttcgggatccagggattcccgactatcaag
tggtttgatggaaagagtgaaacaccggaagattataagggtggacgggatctggagagt
ctgacggccttcgttaccgagaaaacgggcatcaaggcgaagggagcgaagaaggagccg
agtaatgtggagatgttaacggatacgaccttcaagagtgtcgttggtggtgataaggat
gtgtttgttgcgtttacggcgccttggtgtggacactgcaagaaactcgcaccgacttgg
gaaaccctcgccacagacttcgctctcgaacccaacgtcatcatcgccaaagtcgacgcc
gaagccgagagttccaaggctaccgcgaggtcccagggcgtcaccggctaccccacgatt
aagttcttccccaagggctcaaccgagggcattgtctaccagggtgcacgcactgaggaa
gcctttgtcgacttcgtcaacaataatgctggaacgcaccgtgctcctggaggcacgttg
aacgaaaaagccggcaccatccttgcccttgatgagattgttgcgaagtatatcacttcc
aagaactttggcgagctggttgatgaggcgaagaaggttgcgaagactgtcggtggaaag
tacgcggagtactatgttaaggttgcggagaagctggcacagaatgaggagtacgcggct
aaggagcttgagcggttgaagaaggtgctttctaagggtggctctgccccggagaagctg
gacgatatggtctcgcgcagcaatgtattgcgtaaattcttggaagtggaggagaaggtg
gaggacgtcgtgaaggacgagctctag

DBGET integrated database retrieval system