KEGG   Aspergillus nidulans: AN0174.2Help
Entry
AN0174.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ani  Aspergillus nidulans
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AN0174.2
   00330 Arginine and proline metabolism
    AN0174.2
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    AN0174.2
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AN0174.2
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AN0174.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     AN0174.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 364 aa AA seqDB search
MTKNNIVVLGAGVSGLTTAYLLSQDPSNSVTVVAKHMPGDYDIEYCSPWAGANYLPTGQP
GTNHAKWERATWQPLKELTEKHPEAGIHFQESIVHNRKKDQETTTGKWFSALVSENPWYK
DVVPDFKNLPKDQLAPGVDNAQVFTSVCINTAVYLPWLVGQCRKNGAVFKRAVFKHVSDA
ANAHHSGQPADIVVNCTGLASKKLGGVRDDKLYPGRGQIVIVRNDPGKMVSMSGTDDGED
ELMYMMTRAAGGGTILGGCYQKHQWDPLPDPNLAVRIMKRAISICPELVGEGQGIEGLDI
IRHGVGLRPLRDDGPRIEAEMIEGVAVVHNYGHGGFGYQASYGCAAEAVRLVKDTLQKKI
RAKL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaataacatcgtggtgctcggggccggggtgtctgggctcacgaccgcctac
cttctgtcccaggatcccagcaactccgtcaccgtcgtggccaagcatatgccgggagac
tatgatattgaatactgttcaccctgggctggtgccaactaccttccaaccggacagcct
ggcaccaaccatgctaaatgggagcgagcgacctggcagccattaaaggaactgaccgag
aagcatccagaggctggaatccacttccaagaatccatcgttcacaaccggaaaaaggac
caggaaactacgaccggtaaatggttctcagccctggtcagcgagaacccctggtacaaa
gacgttgtccctgatttcaaaaaccttccaaaagaccaattggcgcccggtgttgacaac
gcgcaggtcttcacctcagtctgcatcaacactgcggtatatctaccctggctagtcggc
caatgccgtaagaacggcgcagtgttcaagcgggcagtgttcaagcatgtctcagacgca
gcgaatgctcaccattccgggcaacccgccgatattgtcgtgaactgtaccggcctagca
tctaaaaagcttggcggtgtccgcgacgacaagctctacccaggtcgtggacagatcgtc
attgtccgcaacgatcctggtaaaatggtttccatgtcaggcactgatgacggtgaggat
gaactcatgtacatgatgacccgtgcagctggcggcggcaccattctaggtggctgctac
cagaaacatcagtgggacccattgcctgatcctaaccttgccgtacgcatcatgaagcgt
gccatttccatttgtccggagctggtaggtgagggccaggggattgaagggctagacatt
attaggcacggcgtgggcctgcgtcctttgcgtgatgacgggccgcgtattgaggcggag
atgattgagggtgttgcggtcgtgcataactatggacatggaggatttgggtatcaggct
tcgtatggctgtgccgccgaggcagtgcggttggtgaaagacactttgcagaagaaaatc
cgagcgaagttgtga

DBGET integrated database retrieval system