KEGG   Aspergillus nidulans: AN0174.2Help
Entry
AN0174.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
ani  Aspergillus nidulans
Pathway
ani00260  Glycine, serine and threonine metabolism
ani00311  Penicillin and cephalosporin biosynthesis
ani00330  Arginine and proline metabolism
ani00472  D-Arginine and D-ornithine metabolism
ani01100  Metabolic pathways
ani01130  Biosynthesis of antibiotics
ani04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AN0174.2
   00330 Arginine and proline metabolism
    AN0174.2
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    AN0174.2
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AN0174.2
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AN0174.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     AN0174.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO NAD_binding_8 Thi4
Motif
Other DBs
NCBI-GeneID: 2875951
NCBI-ProteinID: XP_657778
UniProt: Q5BH06 A0A1U8QGK2
Position
VIII
AA seq 364 aa AA seqDB search
MTKNNIVVLGAGVSGLTTAYLLSQDPSNSVTVVAKHMPGDYDIEYCSPWAGANYLPTGQP
GTNHAKWERATWQPLKELTEKHPEAGIHFQESIVHNRKKDQETTTGKWFSALVSENPWYK
DVVPDFKNLPKDQLAPGVDNAQVFTSVCINTAVYLPWLVGQCRKNGAVFKRAVFKHVSDA
ANAHHSGQPADIVVNCTGLASKKLGGVRDDKLYPGRGQIVIVRNDPGKMVSMSGTDDGED
ELMYMMTRAAGGGTILGGCYQKHQWDPLPDPNLAVRIMKRAISICPELVGEGQGIEGLDI
IRHGVGLRPLRDDGPRIEAEMIEGVAVVHNYGHGGFGYQASYGCAAEAVRLVKDTLQKKI
RAKL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaataacatcgtggtgctcggggccggggtgtctgggctcacgaccgcctac
cttctgtcccaggatcccagcaactccgtcaccgtcgtggccaagcatatgccgggagac
tatgatattgaatactgttcaccctgggctggtgccaactaccttccaaccggacagcct
ggcaccaaccatgctaaatgggagcgagcgacctggcagccattaaaggaactgaccgag
aagcatccagaggctggaatccacttccaagaatccatcgttcacaaccggaaaaaggac
caggaaactacgaccggtaaatggttctcagccctggtcagcgagaacccctggtacaaa
gacgttgtccctgatttcaaaaaccttccaaaagaccaattggcgcccggtgttgacaac
gcgcaggtcttcacctcagtctgcatcaacactgcggtatatctaccctggctagtcggc
caatgccgtaagaacggcgcagtgttcaagcgggcagtgttcaagcatgtctcagacgca
gcgaatgctcaccattccgggcaacccgccgatattgtcgtgaactgtaccggcctagca
tctaaaaagcttggcggtgtccgcgacgacaagctctacccaggtcgtggacagatcgtc
attgtccgcaacgatcctggtaaaatggtttccatgtcaggcactgatgacggtgaggat
gaactcatgtacatgatgacccgtgcagctggcggcggcaccattctaggtggctgctac
cagaaacatcagtgggacccattgcctgatcctaaccttgccgtacgcatcatgaagcgt
gccatttccatttgtccggagctggtaggtgagggccaggggattgaagggctagacatt
attaggcacggcgtgggcctgcgtcctttgcgtgatgacgggccgcgtattgaggcggag
atgattgagggtgttgcggtcgtgcataactatggacatggaggatttgggtatcaggct
tcgtatggctgtgccgccgaggcagtgcggttggtgaaagacactttgcagaagaaaatc
cgagcgaagttgtga

DBGET integrated database retrieval system