KEGG   Aspergillus nidulans: AN0174.2Help
Entry
AN0174.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ani  Aspergillus nidulans
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ani00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ani00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:ani00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:ani00311]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:ani04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 364 aa AA seqDB search
MTKNNIVVLGAGVSGLTTAYLLSQDPSNSVTVVAKHMPGDYDIEYCSPWAGANYLPTGQP
GTNHAKWERATWQPLKELTEKHPEAGIHFQESIVHNRKKDQETTTGKWFSALVSENPWYK
DVVPDFKNLPKDQLAPGVDNAQVFTSVCINTAVYLPWLVGQCRKNGAVFKRAVFKHVSDA
ANAHHSGQPADIVVNCTGLASKKLGGVRDDKLYPGRGQIVIVRNDPGKMVSMSGTDDGED
ELMYMMTRAAGGGTILGGCYQKHQWDPLPDPNLAVRIMKRAISICPELVGEGQGIEGLDI
IRHGVGLRPLRDDGPRIEAEMIEGVAVVHNYGHGGFGYQASYGCAAEAVRLVKDTLQKKI
RAKL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaataacatcgtggtgctcggggccggggtgtctgggctcacgaccgcctac
cttctgtcccaggatcccagcaactccgtcaccgtcgtggccaagcatatgccgggagac
tatgatattgaatactgttcaccctgggctggtgccaactaccttccaaccggacagcct
ggcaccaaccatgctaaatgggagcgagcgacctggcagccattaaaggaactgaccgag
aagcatccagaggctggaatccacttccaagaatccatcgttcacaaccggaaaaaggac
caggaaactacgaccggtaaatggttctcagccctggtcagcgagaacccctggtacaaa
gacgttgtccctgatttcaaaaaccttccaaaagaccaattggcgcccggtgttgacaac
gcgcaggtcttcacctcagtctgcatcaacactgcggtatatctaccctggctagtcggc
caatgccgtaagaacggcgcagtgttcaagcgggcagtgttcaagcatgtctcagacgca
gcgaatgctcaccattccgggcaacccgccgatattgtcgtgaactgtaccggcctagca
tctaaaaagcttggcggtgtccgcgacgacaagctctacccaggtcgtggacagatcgtc
attgtccgcaacgatcctggtaaaatggtttccatgtcaggcactgatgacggtgaggat
gaactcatgtacatgatgacccgtgcagctggcggcggcaccattctaggtggctgctac
cagaaacatcagtgggacccattgcctgatcctaaccttgccgtacgcatcatgaagcgt
gccatttccatttgtccggagctggtaggtgagggccaggggattgaagggctagacatt
attaggcacggcgtgggcctgcgtcctttgcgtgatgacgggccgcgtattgaggcggag
atgattgagggtgttgcggtcgtgcataactatggacatggaggatttgggtatcaggct
tcgtatggctgtgccgccgaggcagtgcggttggtgaaagacactttgcagaagaaaatc
cgagcgaagttgtga

DBGET integrated database retrieval system