KEGG   Aspergillus nidulans: AN0352.2Help
Entry
AN0352.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ani  Aspergillus nidulans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AN0352.2
Enzymes [BR:ani01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AN0352.2
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     AN0352.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 2376 aa AA seqDB search
MSNETFYLLPLNDDGSPDVPGGFIYLPPPDHPKYSLRFLIEGSSSICRDGTLWINIPEIG
KSFDRQSFRPFKLYPDFSRNIQIDVPVTCPGSFAYYVTYSPLPEFTITSSAPVKPARTPT
HYIDVSPRLSLAGEGIPLNALSIFSVNSKFMGKYPEDWNQYLNSISRRKYNMVHFTPLMK
RGASNSPYSIFDQLQFDDIAFPNGENDVQKLIKDMEEKHSLLSLADVVWNHTANNSKWLE
EHPEAGYSVETAPWLEAALELDTALLKFSHELQKRGLPTDFKTVDDLTLVMNEVKNHVIE
DLCLWEFYVLDVKSNARRVIDEWKVSTNSDIERGRWAQLDLGAYKAWSLEDQASLIRQKG
VPTAGQILGRYSREIDTQLGVAIATALFGNFDATSSDLTAVENTLRKLLDVVNVPFYKEY
NSDVTEIMSQLFNRIKYLRIDDHGPKLGPVTDQNPLIESYFTRLPLNEITKKHSPKALAL
ANNGWIWNADAMRDNAGPNSRAYLRREVIVWGDCVKLRYGDGPEDNPFLWDFMARYTRLM
AKYFSGFRIDNCHSTPLVVAEYLIDEARKIRPDLAIFAELFTGSEEADYIFVKRLGINAL
IREAMQAWSAGELSRLVHRHGGRPIGSFELDLPSPGLDLSKSQVSGSEREIIRSIRPIPV
PALFMDCTHDNEMPAQKRTATDTLPNAALVAMCDSAIGSVMGYDEVYPKIVDLVHETRLY
SFFDLPESPTLDELVNLKGISGLKRLLNELHTMMGQMGYDETFIHHDGEYITVHRVHPQT
RKGIFLIAHTAFPGQNSGALLAPIHLAATRAKPIGSWLLKVQELSDDKERALSDKVYLQG
LPSEVLKIEGARIEETDRETIISVLDPFIPGSIALFETSIPSLEHADELSNDAITDGAVE
AFSELSLIDLNFVLYRCDAEERDSSGGQDGVYDIPNHGPLVYAGLQGWWSILEGIIRYNE
LGHPLCDHLRQGQWALDYIVNRLMKATKNPQYAALRRPAEWLEAKFQIVRGLPSFLLPRY
FAIIVQTAYVAAWNRGIQLLGDDVRVGQAFTQQLAMVSVQQTGFVNSASLWPKKSVPSLA
AGSGKLPRYNSRDSIWFLLQAIQDYTKMAPDGLELLQDKTPRRFLPYDDTWFPFDDPKAY
SQTSTIVDIIQEVFQRHAQGISFREYNAGPELDVQMKSEGFNIDIRVNWETGLIFGGSQH
NCGTWQDKMGESEKAGNKGVPGTPRDGAAIEITGLLYSALKWVTELNKQGLFPYDKVDIG
NGKSITFEGWAAKVKTNFERCYYIPLDPNDDDQYDIDSGIVNRRGIYKDLYRSGKPYEDY
QLRSNFPIAMVVSPELFDPSKALGALAIADSVLAGPLGMATLDPSDLNYRPDYNNAEDST
DFATSKGRNYHQGPEWVWLRGYFLRALLYFDLARRKTADERTEAFQQVTRRLAGCKKALR
ESPWKGLTELTNRNGNHCADSRPSIVKTNCRYSLASKTRSPLQGGLREYHVWYCYRSLAL
DKPDCSSTVVRLEKQHSASQCFNNGANPSTHLRRQEPPLHKAMSLTESVAAMATAITVAN
HHGTNNGTDDDGPGRKWDDQLKGDLYTQLVISLALGITAFLSFCFLRPKWTELYAARRRQ
RRAALYLPELPDSFFGWIPVLWKITEEQVLQSAGLDAFVFLSFFRFAIRFTSTVFILAFV
VLLPIHYSYTKKLGIPDWDKSIDVGEDGKKKFIDDPPYLWTYVVFTYIFTGLAIFMLFQE
TKKIIQTRQKYLGSQTSTTDRTIRLSGIPAEMGSEENIREFIEGLHIGEVESITLCRNWS
SLDHLIEERLKVLRNLETSWVQYLGYKRVRKSGDTLPLRRQPIDSSIFSEDDERMRLLLE
NGQDDAFDRSRKRPMVRLWYGPLKLRYRKVDAIDYYEERLRRLDEEIQSARQKEYPPTEL
AFVTMKSIAAAQMLVQAILDPHPMKLLARLAPAPADVIWKNTYLPRARRMFQSWSITVLI
CFLSVFWSVLLVPVGTLLKWETLHKVLPQLADALARHPLVKSLVTTGLPTLAFSLLTVAV
PYLYNWLSNHQGMMSRGDIELSVISKNFFFSFFNLFVIFTVIGTATNFYGLWEHLRDSFK
DATTIATALANSLENLAPFYMNVFVLQGLGLFPLKLLEVGSVFLYPINYLMAKTPRDYAE
LSTTATFSYGYSIPQSILILVICVIYGVFPASWLICFFGLVYFTIGNFIYKYQLLYAMDH
RQHSTGRAWPMICNRVLVGLVVFQLAMAGTLGLRKAITLALLIVPLIGATVWFSYFYSQS
YEPLTKFIALKSIYRDTPTSGDISPSTTSTFSPPLALDRDAFPIRLGGQVLGLKLKRYVN
PSLILPLDSAWLPGRNPMPELQEDFEYYEDQNHVSV
NT seq 7131 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgagaccttctacttgcttcccttgaacgacgatggctctccggacgtgcct
gggggttttatctatcttcccccaccagaccatccaaagtattcgctccgattccttatc
gaggggagcagctcaatatgcagggatgggacgctttggataaatattcctgagattgga
aaatcgtttgatcgtcaatcgtttcggccttttaagttatatccggactttagcagaaac
attcagatcgatgtcccagtcacctgtcccgggtctttcgcatactatgtaacctactcg
ccactcccggagtttactatcacatccagcgcgccggtgaagccagcaaggactccgact
cattacattgatgtgtctccaaggctcagtcttgcgggcgagggtataccactcaatgct
ctatcaatattctcggtgaattccaaattcatgggtaagtatccggaggattggaatcaa
tacctgaacagtatctctcggcgcaagtataacatggttcacttcactccgttgatgaaa
cgaggggcatccaactcgccgtatagcatttttgatcaactgcaatttgacgatattgca
tttccgaacggagaaaatgatgttcaaaaactcatcaaagacatggaggagaagcactcc
ctactgtccttggctgatgtcgtgtggaatcacactgccaacaacagcaaatggctcgag
gaacacccagaggctggatacagcgttgaaactgctccctggctcgaagcagcgctggag
ctggacactgcattattgaaattcagccatgaactacaaaagcgcggtctgccaactgac
tttaagactgtcgacgatctgacgctcgttatgaacgaagtgaagaaccatgttatagaa
gacctatgcctctgggagttttacgttctcgacgttaagagcaatgctcggagggttata
gacgagtggaaagtatccacaaacagcgatatagaacgtgggcgctgggcgcagctcgat
ctaggagcctacaaagcgtggtcattggaagatcaggcaagcctcattcgccagaaagga
gtcccgactgcgggccaaatcctcggaagatacagtcgagaaattgatactcaactcggg
gtggccattgctactgcactgtttggaaactttgacgccacgtcgtcggacttgactgcg
gttgagaataccctgcgcaagctgctcgacgtagtcaatgtgccgttttacaaggagtac
aactcagatgtcaccgaaatcatgagtcagcttttcaatcgtatcaagtacctgaggatt
gatgaccatggaccgaagctcggtcctgtgaccgaccaaaatccgctcatagagtcgtac
ttcaccagactgcctctgaacgaaatcactaagaaacacagccccaaagcattagccctc
gccaacaatggctggatatggaacgcggatgctatgcgcgataacgctgggcccaattct
agggcatacctacggcgagaagtgattgtctggggagactgtgtcaaattgcggtatgga
gatggccctgaagacaaccctttcttatgggacttcatggccaggtacactcgcttaatg
gccaagtacttttctggcttcagaattgacaattgtcactccacacctttggtagttgca
gagtacctgattgacgaggcacgaaaaatccgccccgaccttgcaatttttgccgaactt
tttacggggtctgaagaagccgattatatttttgtcaagcggctcggtattaacgcactc
atccgcgaggccatgcaagcctggagcgcgggagagctaagccgtttggtgcaccgtcat
ggtggccgtcccataggcagttttgagttggatctgccctccccaggcctagatctttca
aaatcccaagtgagtggtagcgagagggaaataatacgcagtatacgccccattcccgtt
ccagcgttgttcatggactgtacacatgacaatgaaatgccagcgcaaaagagaacggcg
acagatacactaccaaacgctgctcttgtagcaatgtgtgactctgccattggaagcgtt
atgggatatgatgaagtctatcccaaaatcgtggatcttgtgcatgaaacccgactgtac
tccttctttgatcttccggaatccccaactcttgacgaactggtcaatcttaaggggatc
agtggcttgaagcggctgctcaacgaacttcatactatgatgggtcaaatggggtacgat
gaaactttcattcatcatgatggtgaatacatcaccgtgcatagggtgcatccacaaacg
cgaaagggtatattcttgatcgcccatacagcttttcccggtcagaatagcggagccctt
ctcgcccctatacacctcgctgctactcgagccaagcctatcggatcgtggctcctcaag
gttcaagaactatctgacgacaaggagcgtgccctatcggacaaagtttaccttcaagga
ttgccaagtgaggttttgaagatcgagggtgctcgaattgaagaaacagatcgcgaaact
ataatctcagttttagacccattcatcccaggatctattgcattattcgagacatcaata
cccagtcttgagcacgcagatgagctgagtaatgatgctattactgatggagcagtggag
gcattttcggaactgagcttgattgacctgaactttgtgctctaccgctgcgatgctgaa
gaacgtgattcaagcggtggccaggatggagtctatgacatcccaaaccacggaccattg
gtttatgctggccttcagggttggtggagtattttggaaggcatcatcagatacaatgag
ctgggccatccgctctgcgatcatctcagacaaggccagtgggcccttgactatattgtt
aatcgcttgatgaaagccacaaaaaatccacagtatgccgctcttaggcgtcccgctgaa
tggttggaagcaaagttccaaatcgtccgcggtctaccgagctttcttcttcctcgctac
tttgctataattgttcaaaccgcttatgtggctgcctggaacaggggtatacagctcctg
ggtgatgatgtgagggtgggtcaggctttcacccaacagcttgccatggtcagcgtgcag
cagactggatttgtgaattccgcatcattatggcccaaaaaatcagtcccaagtcttgca
gctggcagcggtaaacttccgcggtataactctcgcgattccatatggtttttgctgcag
gctatacaagattacacgaagatggcacctgacggtcttgaattgctgcaagacaagact
cccagacgattcctaccgtacgacgatacgtggttcccatttgatgatccgaaggcatat
tcgcagacctcaaccatcgtggatataatccaagaagtattccagcgccatgcacaagga
atctcctttcgtgagtataatgcgggcccagagctcgatgtgcagatgaaatcggaggga
ttcaatatcgacatccgcgtgaactgggaaacaggtttgatttttggcggcagccagcac
aactgtgggacatggcaagacaagatgggagaaagcgagaaagccggtaacaagggtgta
cccggtactccacgagatggcgctgctattgaaattaccggactgctttacagtgccctg
aagtgggttacagaacttaacaagcagggcttgtttccttacgacaaagtggatattgga
aatggcaaatctatcacattcgaaggctgggctgcgaaggtgaaaactaatttcgagcgc
tgctattatataccgctggatccgaatgatgacgatcaatacgacatcgactccggaatt
gtgaatcgtcggggcatctacaaagacctttacagatcgggtaaaccttacgaggactac
cagcttcggtctaatttcccaatcgccatggttgtgtcaccagaactgtttgatccttcc
aaagcgctgggtgcgctcgctattgccgattctgtgcttgctggtcccctaggaatggct
acgctcgatccttctgatctgaactatcgcccagactacaataacgcggaagactccacc
gattttgcaacatcaaaaggcagaaactaccatcaaggtccggagtgggtttggctacga
ggatactttctccgcgcactcttgtactttgatcttgcgcgacgcaagactgcggatgag
cggacggaagcattccagcaggtaacaagaaggctagcgggttgcaagaaagctctgagg
gaaagcccttggaagggccttactgagctaacaaataggaacggcaatcattgtgcagac
tcgcggccatcaatcgtgaagacgaactgtcgctactcgctagcctcaaaaacaagatca
ccattacagggtggtttacgagaataccacgtttggtactgctaccgctctctggctctg
gacaaaccggattgctcctcgaccgtcgtccgactcgaaaagcagcactccgcttcccaa
tgcttcaataacggcgcaaacccgtccacacacttaagacgtcaagaacctcctctacat
aaagccatgtcgctcacggagtccgtggcggcaatggcgactgccattactgttgcgaac
catcatggaacaaacaatggaacggacgatgatggacccggacggaaatgggacgatcaa
ctcaagggagacctatatacacagctcgtcatcagcttggcgttaggaataactgcgttt
ctatctttttgttttttgcggcccaaatggacagagttatacgcggctcgaaggcgacaa
cgtcgcgccgcactatatttaccagaacttcccgatagctttttcggatggattccagtg
ctgtggaagataacggaggaacaagttttacagtccgctgggttggatgcctttgttttt
ctctccttcttccgcttcgcgattagattcacgtctacagtgttcattttggccttcgtg
gttcttctgccaatccattacagctacacgaagaagctaggtattccagactgggataaa
agcattgatgtcggcgaggacgggaagaagaaattcattgacgacccgccgtatctatgg
acgtacgtcgtgtttacgtacatctttactggccttgccattttcatgttgttccaagag
acgaagaaaatcatccaaacgagacagaaatacctgggcagccagacgagtacgactgat
cggacgatacgattatcaggtatcccggctgagatgggatctgaagagaatatcagggaa
tttattgaaggcttgcacatcggagaggttgaaagtattacgctatgccgtaattggagc
tctttggaccatctgattgaggagcgacttaaagtgctacggaatttggaaacatcttgg
gttcagtaccttggctacaagcgagtcaggaaatctggcgacactttgcctttgagacgc
cagccaatagattccagtattttctctgaggacgacgaaaggatgcgccttttgctggaa
aacggacaagatgacgcatttgatcggtctaggaaaagaccaatggtgcgtctatggtat
ggtccgctgaagctacggtaccggaaggttgatgctattgactactacgaagagagactc
cggaggcttgatgaggaaattcagagcgctcgtcagaaggaatatccgcctactgagctc
gcgtttgtgaccatgaaatcaatagctgcggcgcagatgctcgttcaggctatacttgat
cctcatccgatgaagctccttgccagattggccccggccccggcggatgtgatttggaaa
aacacctatttaccgcgtgctcggcgcatgtttcagtcatggtctattactgtattaatc
tgcttcctatctgtgttctggtccgtgttacttgtgcctgttggtacactgcttaaatgg
gagacactccacaaggtcttgcctcaactggccgacgctttggctcggcaccctctcgtc
aaatcacttgtcaccactggtcttcctaccttggccttctctctcttgactgttgctgtt
ccctacttgtataattggctttcgaaccaccagggaatgatgtctcgaggcgacatcgaa
ctttccgttatctcgaagaatttcttcttctcgttcttcaatctattcgtcatattcact
gtcatcggcactgcaacgaatttctacggtctctgggagcatcttcgggactccttcaaa
gatgcaaccactatcgcgacggctctcgccaattcgctagaaaaccttgctccattttac
atgaacgtctttgttcttcagggtctaggcttgttcccactcaaactccttgaggtcgga
agcgtatttctgtaccctattaattacttgatggccaaaacgcctcgagattatgccgag
ctctccacaacagctacattcagctacggatattcgattccacaatcgatactgatactg
gtcatctgtgtgatttacggcgtattcccagcatcttggctgatttgcttctttgggctg
gtctacttcacaattggtaactttatctacaagtatcagctcctatatgcgatggaccat
cgacagcactctacaggacgagcatggcccatgatatgcaaccgtgtcctagtgggtctg
gtagtgttccaacttgctatggcaggcactcttggtttgcgcaaagcaattaccttggcg
ctgctcattgtgcccctgatcggagccacagtgtggttcagctacttctattctcagagc
tatgagccgttgaccaaatttattgctctaaaaagcatttatcgcgacacaccgacatct
ggtgatatctctccctctacaacttcgacgttctcaccgcctcttgctctcgaccgtgat
gcgttcccaatccgactaggagggcaagtgctaggactcaaactgaagagatacgtcaac
cccagtctcattttacctctagacagtgcttggctcccaggacgcaatccaatgccagag
cttcaagaggacttcgagtactacgaggatcagaaccacgtttcggtgtaa

DBGET integrated database retrieval system