KEGG   Aspergillus nidulans: AN0359.2Help
Entry
AN0359.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ani  Aspergillus nidulans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AN0359.2
Translation factors [BR:ani03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AN0359.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 738 aa AA seqDB search
MAPSFENLSEQDLHEEEEEEIDFSDLKAQYEVKLEEGLDTFVVIDGLPVVPEENRQKLIK
FLLRKLNTVGHTSEDAVFMPLNEKNMSEGFAFVEYETAEQAVAAVKQLHGTPLDKKHTLL
VNKLMDIERYGREGRIDEEYKPPNIEPFTEKEHLRSWLGDPNARDQFALYRGDKVGVFWN
NKSNPPENVVDRAHWTQLFVQWSPKGTYLASVHPQGVQLWGGPTFSKQKQFPHPFVSLIE
FSPGESYLTTWSARPIQVEEGHPVLTYEEDGKNIIVWDIVTGKPLRSFVSHDLAGPESEA
QPKKKVQWPAFKWSADEKYVARMLQGQSISIYELPRMNLLGKTSVKIDGVMDFEWSPATV
NRDGVKQYEQLLCFWTPEIGSNPARVALMSVPSKEIVRTRNLFNVSDVKLHWQSQGNFVC
VKVDRHSKSKKSMATNLEIFRVREKGVPVEVVDSLKDTVINFSWEPNGARFVLITTGDAS
GAGAPPKTAVSFFAPEKKGVQAGNFKLVRTIEKKTSNAIYWSPKGRFVVVATVHSQSNFD
LDFWDMDFEGEKNDNEKDLAANLQLMKTVDHYGVTDIEWDPTGRYVVSGASAWTHQMENG
FNLHTFSGETLAENPTDKFKQFLWRPRPPTLLSKEEQKQVRKNLREYSKEFEEEDKYAVD
IANTAVVEKRKRVLNEWVAWLKREKELLTEEKEAYGLPEEADQPKAAKDAPTNTEDKGET
VVEEIVEEIVEESEEIIG
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcacctagcttcgagaacctgtcggagcaagatctccacgaagaagaggaggaggag
attgacttctccgacctcaaggcgcagtacgaagtgaaacttgaggagggcttggacaca
ttcgtcgtcatcgatggactcccagtcgtaccagaagagaacagacagaaactcatcaaa
ttcttgctgaggaaactcaacacagtcggccacacctccgaagatgccgtcttcatgccc
ctcaacgagaagaatatgtccgaaggatttgcctttgtcgagtacgaaaccgcagagcaa
gccgttgccgccgtaaagcagctgcacggaacgccccttgataagaagcatactctcctc
gttaacaaattgatggatatcgaacgttatggccgggaaggacgtatcgacgaggaatat
aagcctccgaatatcgaaccattcacagagaaggagcacctgcgctcgtggctcggggac
cccaatgcccgtgaccagttcgccctttaccgcggcgacaaggttggggttttctggaac
aacaagagcaacccgccggagaatgttgtcgaccgtgcccattggacacagcttttcgtc
cagtggtcccccaagggtacatatctcgcctctgttcacccacagggggtgcaactgtgg
ggtggtccgactttctccaagcaaaagcaattccctcatccctttgtttctctcatcgag
ttctcgcctggcgagagctacttgactacctggtctgcccggcctatccaggtggaggag
ggccaccccgtactgacatacgaagaggatggaaagaatatcattgtctgggacatcgta
acaggcaagcctctccgatcatttgtttcccacgatctcgccggtcccgaaagcgaagcg
cagcccaagaagaaagttcagtggccggcttttaagtggtccgctgatgaaaagtacgtg
gcgagaatgcttcagggccagtcgatctccatctacgaacttccccggatgaacttgctc
ggtaagacgtcggttaagattgacggagtgatggacttcgaatggtcgccggctacagtc
aaccgtgacggtgtcaagcagtacgagcagctcctatgcttctggactcccgaaatcggc
agcaaccctgcccgagtcgcccttatgagcgtgccttccaaggagattgttcgaactcgt
aaccttttcaacgtttccgatgtgaaactgcactggcaatcccagggtaacttcgtttgc
gttaaggtggatcgtcactcaaagtctaagaagtctatggccaccaacctcgaaattttc
cgcgtacgggagaagggtgtcccggttgaagtggtagacagtctcaaggacaccgtgatc
aacttctcgtgggaacccaacggtgctcgcttcgttctcatcacgactggtgacgcatct
ggggctggtgcgcctcccaagacggccgtctcgttcttcgctccggaaaagaaaggtgta
caagccggcaactttaaacttgttcgcactattgagaagaagaccagcaatgctatttac
tggtctcctaagggccgtttcgtcgtggtggcgactgttcactcgcaatcaaactttgac
cttgatttctgggatatggatttcgagggtgagaagaacgataacgagaaggatctagcg
gccaacctgcagctgatgaagaccgtcgaccactatggtgtcacagatattgaatgggat
cccacaggtcgttacgttgtcagtggtgctagcgcgtggacgcaccagatggaaaacgga
ttcaaccttcacaccttctccggagagactcttgcggagaaccctacggacaagttcaag
cagttcctctggcgtcctcgccctcctactcttctcagcaaagaagagcaaaagcaagta
cggaagaacctccgcgagtactcgaaggaattcgaggaggaagacaagtatgctgtcgac
attgccaacaccgccgttgtcgagaagcgcaagcgtgtcctcaacgagtgggttgcttgg
ctcaagcgcgagaaggagctactcaccgaggagaaggaagcctacggcctacccgaagaa
gccgaccaacccaaggctgccaaggatgcgcccaccaacacagaggacaagggcgagacg
gtggtcgaagagattgtggaagagattgtggaggaaagcgaggagattattggttga

DBGET integrated database retrieval system