KEGG   Aspergillus nidulans: AN0410.2Help
Entry
AN0410.2          CDS       T01016                                 

Definition
PP1_EMENI SERINE/THREONINE PROTEIN PHOSPHATASE PP1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ani  Aspergillus nidulans
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    AN0410.2
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    AN0410.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AN0410.2
Protein phosphatases and associated proteins [BR:ani01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     AN0410.2
Transcription machinery [BR:ani03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     AN0410.2
Messenger RNA biogenesis [BR:ani03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     AN0410.2
Spliceosome [BR:ani03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    AN0410.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 323 aa AA seqDB search
MADQDVDLDSIIDRLLEVRGSRPGKQVQLLESEIRYLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFVL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVYGAMSSGRPITPPRKQKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaggacgtggatctggattctatcattgacagactgctggaggtgaggggc
agccggcccggaaagcaagtccaacttctggaatcggaaatccgctatctctgcacaaag
gcgagggaaatctttatctctcagcccatcctacttgagttggaggcacctatcaagatc
tgcggtgatatccatggccaatactacgacctactccgcctcttcgaatacggtggtttc
ccaccggaagccaactacctcttcctcggagactacgttgaccgtggcaagcagtcactc
gagacgatctgccttcttcttgcctacaagatcaagtatcctgagaatttcttcgttctt
cgggggaaccacgagtgcgcttctatcaaccgtatttacggtttctacgatgagtgcaag
cggaggtataacatcaagctgtggaagaccttcacagactgtttcaactgccttcccatc
gcggctatcattgatgaaaaaatctttaccatgcacggtggtttgagccctgacctcaac
tccatggaacagatccgccgtgtcatgcgtcccactgatatccccgattgcggcctcctg
tgtgaccttctatggtccgatcctgacaaagatatcacgggatggagcgaaaatgaccga
ggtgtttcattcacatttggaccggacgtagtatcgcgtttcctccagaaacatgatatg
gatttgatatgccgcgcacatcaagtcgttgaggacggctacgagttcttttccaagagg
cagctggttacactattcagcgctccgaactactgtggagagttcgataatgctggtgca
atgatgagtgtggatgagagtttattgtgctctttccagattctgaaaccagcagagaaa
aaacaaaagtacgtttacggggcaatgagctcaggccgacccatcactcctccgcgaaag
caaaagaagtaa

DBGET integrated database retrieval system