KEGG   Aspergillus nidulans: AN0410.2Help
Entry
AN0410.2          CDS       T01016                                 

Definition
PP1_EMENI SERINE/THREONINE PROTEIN PHOSPHATASE PP1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ani  Aspergillus nidulans
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:ani03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ani04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 323 aa AA seqDB search
MADQDVDLDSIIDRLLEVRGSRPGKQVQLLESEIRYLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFVL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVYGAMSSGRPITPPRKQKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaggacgtggatctggattctatcattgacagactgctggaggtgaggggc
agccggcccggaaagcaagtccaacttctggaatcggaaatccgctatctctgcacaaag
gcgagggaaatctttatctctcagcccatcctacttgagttggaggcacctatcaagatc
tgcggtgatatccatggccaatactacgacctactccgcctcttcgaatacggtggtttc
ccaccggaagccaactacctcttcctcggagactacgttgaccgtggcaagcagtcactc
gagacgatctgccttcttcttgcctacaagatcaagtatcctgagaatttcttcgttctt
cgggggaaccacgagtgcgcttctatcaaccgtatttacggtttctacgatgagtgcaag
cggaggtataacatcaagctgtggaagaccttcacagactgtttcaactgccttcccatc
gcggctatcattgatgaaaaaatctttaccatgcacggtggtttgagccctgacctcaac
tccatggaacagatccgccgtgtcatgcgtcccactgatatccccgattgcggcctcctg
tgtgaccttctatggtccgatcctgacaaagatatcacgggatggagcgaaaatgaccga
ggtgtttcattcacatttggaccggacgtagtatcgcgtttcctccagaaacatgatatg
gatttgatatgccgcgcacatcaagtcgttgaggacggctacgagttcttttccaagagg
cagctggttacactattcagcgctccgaactactgtggagagttcgataatgctggtgca
atgatgagtgtggatgagagtttattgtgctctttccagattctgaaaccagcagagaaa
aaacaaaagtacgtttacggggcaatgagctcaggccgacccatcactcctccgcgaaag
caaaagaagtaa

DBGET integrated database retrieval system