KEGG   Aspergillus nidulans: AN0582.2Help
Entry
AN0582.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ani  Aspergillus nidulans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AN0582.2
   03420 Nucleotide excision repair
    AN0582.2
   03430 Mismatch repair
    AN0582.2
   03440 Homologous recombination
    AN0582.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 278 aa AA seqDB search
MDSYGGYGGNSYGSGGGGFMPGETTSPSGGRQEWNNTTLRPVTIKQILDATQPYPEANFT
IDGQDVSSIVFIGQVRNISTQATNVTYKLDDGTGEVEAKQWINPSEAMDTTEDFGKEGKD
LNGVEINGYAKVFGKLKSLFGDRKVVNTHCVRPLTDINELHVHFLEAAAVHLFHTRGAPG
PAAGATGKIDGGDAAMGGLDGAGVGGGGGFPANMSATARRVYNLLRTEPQNNEGLHAQFI
AAKLGLPPQDVVRAGDELINAGMVFSTVDDQTWVILEY
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggactcctacggcggctacggaggtaactcatatggaagtggcggtggtggcttcatg
cccggcgagacaaccagtccgtctggaggaaggcaagaatggaacaacacaacccttcgc
cccgtaacaatcaaacaaatcctcgacgcaacgcagccctacccggaagcaaacttcaca
atcgacggacaagacgtatccagcatcgtcttcataggccaagtccgcaacatcagcaca
caagccacaaatgtcacatacaaacttgacgacggcacgggcgaggttgaagcgaagcag
tggataaatccgtccgaggcgatggacacgaccgaagatttcggcaaggaagggaaggac
ctgaatggtgtggagatcaacggctatgcgaaggtattcgggaagctgaagagtttattt
ggagaccgcaaggtcgttaacacgcattgcgtgcggccgttaacggatatcaatgaactg
catgttcactttttggaggccgccgcggtgcacttgtttcatactagaggcgctccaggg
cccgctgcaggtgctaccgggaaaatcgatggtggtgatgcggcgatgggagggcttgat
ggggccggggttggtggcggtggtgggttcccggcgaatatgtctgcaactgcaaggagg
gtttataacctgctcaggacggagccgcagaataatgagggcctgcatgcgcaattcatt
gcggcgaagctgggccttcctccgcaagacgttgtgcgtgcaggtgatgagctgatcaat
gctggcatggtgttctcgaccgtggacgatcagacctgggttattctggagtattaa

DBGET integrated database retrieval system