KEGG   Aspergillus nidulans: AN0664.2Help
Entry
AN0664.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ani  Aspergillus nidulans
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AN0664.2
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AN0664.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     AN0664.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 1141 aa AA seqDB search
MTYAATSSTSAVHGDPQASLKLAASRPRPKLHHIFTSSAIPAALAPTYASSYTTTPTSLP
PSCTPSNDSSPLGTPFLSAVDSLRDRVTPLPPTSAPSLELGDSIMAVPATISASYPGDTV
IPNSIKGTGLMRRISRGAANKLTRRRTSNSHNDKRDRSSGPVIMRRRSDSKTGTQTGRDS
ALDSSYEEDSNDALDALGGWAGSEASSVPNDNTPTVPRNPAVVAPTVDSAIQRGTILTKV
TKKRRKQVRFLLNLDAGKVYWDPSNPAKRFYIDDVKEIRVGADARNYREEHQVSQDAENR
WFTIVIADAERSKGRPVKTIHLIAPNERLLKLWTTTLEYISRYRVGLMAGLAASNQNESV
LKAHWQREMTRLFPNGMKAGDTETLDFAAVESVCQSLHINCSQNMLRAHFLKADTGKHGK
LNFDEFKDFVTRLRERRDVREIFRSHADDHREGLTLEEFLIFLRDVQKEDIDSDRAYWIS
VFDKLVRKSKSRTQSPTGTSSEDQSSRMSLDAFSSFLASARNGVYASRSPQSRFDRPLNE
YFISSSHNTYLLGRQVAGSSSTEAYISALTQGCRCIEIDCWDGADGRPIVSHGRTMTTSV
LFADCITVINRYAFFSSEFPLVISLEVHCNPEQQIAMVKIMKETFGEKLILEPLSNSFVL
PSPEELKRRILIKVKTCDETENIRQDPITSFHGRKRSSSSPFIRPSMSDGPTLPNLPSLS
SPPTIGADCPGPFLVPERRSLTTTSISSATEDSDGGLVSVRKERRRRQKSKITKPLSDLG
VYTRGYKWHSFASAESQAFNHVYSFAERSFESICREPSNKALFEKHNSKYLTRVYPSGFR
LRSSNFDPLKFWRRGVQMAALNWQTYDIGMQMNQAMFAAGSDRTGYVLKPESLRVVSSEK
DTRITERKLVRFSVDVISAQQLPRPQNMSSDGNINPYVEIEMFSADDRGQSFAFGEGGMN
ASARNGMSGIGFPHRRRTKIEQRNGYSPNFNESFRLSLETKYPDLVFVRWTVWSSLDGRS
TGTNGSVQLATFTAKLTSLSQGYRYLPLYDGSGDQYIFSTLFCKISKEEPISVRRLNADE
LRAERLGILRQIGQTVFKRTSSTEREKQDQSDKGTETPICLEGKEISPALTPTISTTSTA
S
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atgacttatgcagctacctcatcaacctcggccgttcatggcgaccctcaagcaagttta
aagcttgctgcttcacgccccaggcctaagctacatcatatttttacttcatcagcaata
cctgctgctctggcacctacctacgcgtcttcatacacaacaactccaacatctctacct
ccctcttgcactccgtcaaatgattcaagccctttgggcacccctttcctctcagcagtc
gactcccttcgggatcgagttacaccacttcctcccacctctgcgccttctctagagctt
ggggatagcatcatggctgtccccgcaaccatcagtgcttcctacccgggagatacggtt
atcccaaactctatcaagggtacgggcttgatgcgccgaatctctagaggcgctgcgaat
aagctcactagacgaagaacttcgaattcccacaacgacaaacgtgaccgcagctccggc
cctgtcattatgcgccgccgcagtgatagtaaaactgggacgcaaactggccgcgacagt
gcccttgattccagctatgaagaagacagcaacgatgctctcgatgcgttaggtggatgg
gccggttcagaggcgtctagtgttccaaacgacaatactccgactgttccccgcaacccg
gctgtcgttgcacctacggtagattcggctattcagcgcggaactattctcaccaaagtt
acgaaaaaaagaagaaagcaagtacgctttctactcaatctagacgcaggcaaagtctac
tgggatccctcgaatccagccaagcggttctatatcgacgatgtcaaagagattcgggtt
ggtgcagatgcacgcaattaccgagaagagcatcaagtttcccaagatgcggagaatcga
tggtttacaattgtgatcgcggatgccgagcgatccaaaggccgaccagtcaagacgata
caccttattgccccaaacgaacgtctgctgaaactttggacgacgactttggagtatatt
tcgcggtaccgggtggggcttatggctggtctggcagcctcaaaccaaaatgaatcggtt
ctaaaagctcactggcagcgcgaaatgacgaggctttttccaaatggaatgaaagcagga
gacacagagacgctcgatttcgcagccgttgaaagcgtttgtcaaagtctgcacattaac
tgttcccagaatatgttacgcgctcatttcttgaaggctgatactggcaagcacgggaag
ctcaatttcgatgaattcaaagacttcgtcacacgtctaagagagcgaagggatgtccga
gagatcttcaggagccacgccgacgatcatcgtgagggcttgacattggaggagtttcta
atcttccttcgcgacgtacagaaggaggatatagattctgaccgcgcgtattggatatct
gtctttgataaacttgtcagaaagtcgaaatcgcgcacacaaagccctactggtacgagc
tctgaggaccagtcttctcgcatgagtctcgatgctttctcctcgtttcttgcctctgcc
cgcaatggggtgtatgcctctcgctcgcctcagtccagatttgaccggccgttgaacgaa
tattttatctcaagctcccacaacacctatcttcttggccgacaagtcgcagggtcttct
agcaccgaagcgtatataagcgctttaacgcagggatgccgctgtatagagatagattgc
tgggatggtgcagatggtcggcccattgtgtctcatggaaggaccatgaccactagtgtc
ttgtttgccgattgtatcaccgttatcaaccgctacgccttcttttctagcgagtttcca
ctcgtcatatcccttgaagtgcactgcaaccctgaacagcaaattgctatggtgaaaatc
atgaaggagaccttcggagaaaagctgatcttagagccgctttctaactcattcgttctc
ccctcgccagaagagctcaagcgtcgtattctcatcaaggtcaagacgtgtgatgagacg
gaaaatatacgacaagacccaataacttcatttcatggtcggaagcgaagctcaagttct
cctttcattcgcccttcgatgtccgatggacctacattacctaaccttccgtcgctttca
agtccacccacaataggtgcagattgcccgggtccattcttggtacccgagaggaggtca
ttgactaccaccagcatcagcagcgccactgaggacagtgacggtggtcttgtctccgtc
aggaaagagagaagaaggcggcaaaagagcaaaatcactaagccattgtccgacttggga
gtgtacacacgcggctacaaatggcatagctttgcctctgcggagagccaagcattcaac
cacgtttactcctttgccgagcggtcttttgaaagtatttgtcgggagcccagcaacaag
gcccttttcgagaagcataattcaaaatatctgacgcgggtatatccctccggttttcgg
ctacgatcgtctaacttcgacccccttaaattctggcgacgtggtgtccagatggctgcg
ctcaactggcagacttatgacattggtatgcagatgaatcaggccatgtttgctgcagga
agcgaccgtactggatatgtgctcaagccagagtctctccgtgttgtctcatcagagaaa
gacacgagaatcacggaaaggaaacttgtccggttctccgtcgatgtcatttccgctcag
caactcccccgaccacaaaatatgtcttcggacgggaacatcaatccatatgtcgaaatt
gagatgtttagtgcggacgatcgtggtcaaagctttgcattcggcgaaggtggcatgaac
gcttctgcccgaaacggcatgtcaggcatcggctttccgcatcgccggcgcaccaagatt
gagcaacggaacgggtacagcccaaacttcaacgaaagttttcgtctgtcactggagaca
aaatacccggatttggtgtttgttcgctggactgtctggagctcacttgatggccgaagc
acgggaaccaacggcagtgttcaactggccacgttcaccgctaagctcaccagcctctcc
caagggtaccggtatcttcctctgtatgatggaagcggtgatcaatatatcttttcaacc
ctgttctgcaagatttcgaaagaggaacccatttctgttcgccgactgaatgccgacgaa
ctcagagccgagcggttgggtatacttcgtcaaatcggccaaacggtcttcaagcgcacc
tcgtcaaccgaacgggagaagcaagatcaatcagacaagggaactgagacgccaatatgt
ctagagggcaaagagatatctccggcgttgaccccaaccatttcgaccacctcaacggcg
tcataa

DBGET integrated database retrieval system