KEGG   Aspergillus nidulans: AN0855.2Help
Entry
AN0855.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ani  Aspergillus nidulans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ani03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 1011 aa AA seqDB search
MVFKPFKPLSIRKPPQPADPTQKPSIKPLETDDGPPAKRPRLFSQDTSNTENTRTTLANQ
RKPLIQVTNVSEASALTSGGSGDGSAYVDSSLPEARRKPTTKKNKIWDGDGIVSVRDGYV
YLQDISGRAMGRAMYGSVLKPGVILSVGGKEVEIDTEIPKEEYLSGKRSLMTKTEAPTPP
SLTRPLPSKKTSVPVLMSREKDISRSEISAPSPGLAETRVKESQAANLASRGSISGAYKR
PLLESTVMPAASLDEPTPRHDPKQPGALIMKRPGSAPKGKRIVDVVVDPILAKHLRPHQR
EGVKFLYECVMGMRSFNGEGAILADDMGLGKTLQTITLLWTLLKQNPIYEAAPVIKKALI
VCPVTLINNWRREFRKWLGNERIGVFVFDDKRKRLTDFTMGKAYSIMIVGYEKLRSVQEG
LARGNGVDIVIADEGHRLKTLQNKSGQAIQSLNATKRIILSGTPIQNDLKEFFAAVDLVN
PGVLGSFKSFIKEFEGPIVRSRQPEATEKDIEKGEARNEELRELTSQFMLRRTADILADY
LPPKTEYVLFCKPTNTQAKIYQNVLASPVFQGALGNSESALQLITILKKLCNSPSLLSLK
DANEKPSETIAAILSSLPPNLLRHFSPSCSAKIRVLDQLLHYLRTSTSEKVVLVSNYTST
LDLLANLLSSLSLPFLRLDGSTPAQKRQSLVEDFNRHPASTCFAFLLSAKAGGTGLNLIG
ASRLVLFDVDWNPATDIQAMARIHRDGQKHHCHIYRILLQGSLEEKIWQRQVTKIGLADS
VMEHKDSVAQFSRDELRDLFRLDVVSKCQTHDLLACGCGGKGYSTASGNDHTPQQEPEGL
SEDDDESDISCLKFPTLMKATEVNMEEQERFFATGGRGPRASVLTSKNSGSGNTNSSKQK
IKESLSHYVHIDPSLFMPSTSTLENFGAGGLDQVLGDEVLRSLLTDEENRVQFLFKKSTE
PEVKQTPFAADDGAGATPKSRTNSTCRSEPEDGAEARAGNGTADSPVDLSD
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atggtctttaagcccttcaagccgctctcgataaggaagccacctcagcctgccgatcca
acccaaaaaccatccataaagcctctcgaaaccgatgacggcccgcctgcaaagcggcca
cgactgttttcccaggatacaagcaacactgagaacacgcgtactacgttagcgaaccag
aggaaacctttgattcaggtcactaatgttagcgaggcgtctgcccttactagcggcgga
agtggcgatggaagtgcatatgtagactcatccttgcctgaggcgaggcggaaacccacc
acaaaaaagaacaagatttgggacggcgacgggattgtctcagtgcgagatggatacgtc
tatctgcaggatatctcggggagggctatgggccgggcgatgtatggttctgtcctgaag
ccgggcgtcatactttcggtcggaggaaaagaagttgaaattgatacggagattcccaag
gaagagtatctctctgggaagcggtctttaatgactaaaaccgaggccccgacgccgcca
tcgcttacaaggccattaccatcaaagaagacgtctgttcccgtgctgatgagccgggag
aaagatatatctcgatccgaaatatcagcacctagtccgggactggccgagacccgggtt
aaggagagtcaggccgcgaacttagcaagtcgagggtctatttcaggggcttataagagg
cctttactcgagagcacggttatgccagctgcttcgttagatgagcctactccccgccat
gatcctaagcagcctggggcattgataatgaagcggccgggctcggcgcccaagggaaag
cgcatagtggatgttgttgtggatcctattttggcaaaacatctccggccgcaccagcgc
gagggcgtgaagttcttgtatgagtgtgttatggggatgcgatcattcaatggcgaaggc
gcgattctagctgacgacatgggtttgggaaagacattacagaccatcactctgctatgg
actctactaaaacagaatccgatttacgaggccgctccagtgattaagaaagctcttatt
gtttgcccggtcacattgataaataactggaggagagaattccggaaatggctcggaaac
gagcggattggggtctttgtttttgatgataagaggaagcgattgactgactttacaatg
ggaaaagcctatagcatcatgatcgtcggctatgagaaactgaggtctgtgcaagagggg
ctggcgcgtggtaatggtgtcgatatcgtcattgcagacgaagggcatcgattgaaaacg
ctccagaacaaaagcgggcaagctatccaatcattaaacgctacgaagagaataatcctc
tcgggtacacctatccaaaatgacttgaaagaattctttgccgcagtggatcttgtcaat
ccaggcgtcctgggatcgttcaagtccttcatcaaggagttcgagggtccgatcgtgagg
agtagacagcctgaagctaccgagaaggacattgaaaagggagaggccagaaatgaagag
ctccgagaattaacatctcagtttatgctgcggagaacggccgatatccttgcagattac
ctgcctccgaagacggaatatgtgcttttttgcaaaccaaccaatacgcaggcgaagata
taccagaacgtgcttgcttcgccagtctttcagggcgccctgggtaattccgaaagtgct
ctgcagctgatcacgatcctcaagaaactgtgcaatagtccatctctgctttcattaaag
gatgccaacgaaaagccgagcgagaccatcgctgccatcttgtcatccttgccacctaac
cttctgcgtcacttctccccgtcatgcagtgctaagattcgcgtcctagaccagctactc
cactacctacgcacatcaacctctgaaaaggttgtgcttgtctcaaactacacttcaacc
ctggatcttctcgccaaccttctaagctctctctcgcttcctttcctccgccttgacggc
tccactcctgcgcaaaagcgccaaagcctcgtcgaggactttaaccgccacccagcgagc
acttgctttgcatttctcctctccgcaaaggccggaggaaccggtttaaacttgattggc
gccagccggctcgtcctctttgacgtagactggaaccctgccacggacattcaagccatg
gcgcgcatccaccgcgatggccagaagcatcactgccatatctaccgtatccttctgcag
ggcagtttagaggaaaagatatggcaacggcaggtgacgaagatcgggcttgcggatagc
gtgatggagcataaggatagtgtcgcgcagttctcgcgcgacgaacttcgggacctcttc
aggctggatgtggtgagtaaatgccagacgcatgatctcctagcctgcggctgcggtggg
aaagggtattccaccgcttcaggtaatgaccatacgcctcaacaagaaccggaaggactc
agtgaagatgatgacgagtcagacatatcctgcctaaaatttccaacccttatgaaagcc
actgaagtgaacatggaagaacaagaacgattttttgcaacaggaggcagaggcccacgt
gcgtcagtattgacgagtaagaactctggcagcgggaacaccaacagcagcaagcagaaa
ataaaagaaagcctctctcactacgtacacatcgacccctctcttttcatgccatcgaca
tcgacattggaaaactttggggctgggggtcttgatcaagtcctgggggatgaggtcttg
cgttctcttttaacagacgaggagaaccgggtgcagtttttgtttaagaagtcgacggag
cccgaggtgaagcaaacgcctttcgcggccgatgatggcgccggggcgacgcccaagtcc
aggaccaactccacgtgtagatccgaacccgaagatggagccgaagctagggcaggaaat
ggcacggcggactcaccagtggatttatcggattag

DBGET integrated database retrieval system