KEGG   Aspergillus nidulans: AN0929.2Help
Entry
AN0929.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ani  Aspergillus nidulans
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ani00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 728 aa AA seqDB search
MDSDKSAKGHYLGVETRLPSAQNPSQDSAATSEANTTRQRRVSVSKVTVRQSFHYPTSAG
ALNHQVPNANESVTKEDIDRWLKQSEEESRHNLFSQVYEWLSREKSKRKHSNKSNGSTNG
SGNGFDGEGDAHGDGAQLTRTVSQGSDTTLALDALEKILLQYASRYDSRTMSTCSSRRST
RRRHPIKGLRRGSVSESDYELDPITPAVDAVLDNSRTLSYTGGGVESEDGDAASITRAKD
REAWVVFKSELLRLTHTLQLKGWRKIPMELASEIDVVRLSGALTNAVYKITPPQNIPPPK
AEDGSYTLVPRRPPPKLLLRIYGPQVDHLIDREKELQILRRLGRKNIGPKVLGTFNNGRF
EEYFEARPLTPKELRDPSTMKQIAKRMRELHDGIDLLDEERENGPMVFHNWDKWVDRCEQ
VISWVDAEIKSPLNEGKAASEPWRRRGYVCGVPWPKFRKAVEDYRKWLIVDSGGVHEIKR
QLVFGHNDTQYGNLLRMEPSQQSPLLLPQNEHKQLVVIDFEYASANTPGLEFANHFTEWC
YNYHDAEKPWACNNQLYPTPEQQHQFVTAYLTHRPGLGSRVSPSITPIMRPLSASTPTMT
PLDLNATSPDLAPQRPPDNIERSAQDTLEAETQFLIRQTRLWRVLNSAQWVAWGIVQAKV
PGMEDDGSSTPTPPVDSDVDESDEFDYLAYAQDRAFFFWADLVALGFVQKEQLPESLAEV
VDGRILEY
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggattctgacaagtctgcaaaaggccactatctaggtgtcgagactaggctgccctcc
gcccagaaccccagtcaggactctgcagcgacttccgaagcaaataccaccagacagcgt
cgcgtgtctgttagtaaggtcaccgtacgccagagttttcactatccgacttccgcaggc
gctttgaaccaccaagtacccaatgcgaacgaatcggtaacgaaagaagacattgaccgc
tggctcaagcagagtgaggaggaatcgcgccataacctcttcagtcaggtgtacgaatgg
ctctcgcgcgaaaagtccaaacgcaagcattcgaataagtccaacggatcgacaaacggc
tccggtaatggctttgacggcgagggtgatgcacatggtgatggcgcccagttgacgagg
actgtgtcgcagggctctgacactaccctcgcactcgacgccctggaaaagattctgctg
caatacgcttctagatatgattcccgaactatgtctacttgttcctcacgtcgatccacg
cgccggcgtcatccgattaaaggcttacggagaggctctgtttccgagtcggattatgaa
ctcgacccgatcactcctgccgtggacgcagttctggacaactcgaggacgttatcttat
actggtggtggtgtagaaagtgaagacggcgatgctgctagcattacgcgagctaaagac
cgagaagcctgggttgtcttcaagagcgaacttctccgcttgacccatacgctgcagttg
aagggttggcgaaagatcccaatggagctggcaagtgaaattgacgtggttaggctcagc
ggtgcattaacaaacgctgtttacaaaatcacccctccccagaacattccgccccccaaa
gccgaagatggatcttatacgctggtacctaggagacctcctccgaaacttttgttacgt
atctatggcccacaagtggaccatcttattgatcgagagaaggagctacagattcttcga
cgcctgggacggaagaacattgggcccaaggtgctaggaacgttcaacaatggccggttt
gaggagtactttgaagcgcggcccctaacgccgaaggagctccgggacccgtcgacgatg
aagcagatcgccaaacgcatgcgcgagttgcacgacggtattgacctgctggatgaagag
agagagaatggcccaatggtgtttcacaactgggacaagtgggttgatcggtgcgagcag
gtgattagctgggtggatgcggaaatcaaatcgccgctgaacgaaggcaaagctgcgtcc
gagccctggcgtagacgtggatatgtctgcggtgtaccttggcccaaattccgcaaggcc
gtggaggactaccgtaaatggcttattgtggacagtggtggcgtacatgagatcaaacga
cagcttgtgtttggccataacgacacacagtatggcaacttgctgcgtatggagcctagc
cagcagtctccccttctcctcccgcagaacgagcataaacaattggtcgtcatcgacttt
gagtatgcctcagcgaatactcccggtttagagttcgccaaccattttactgagtggtgc
tacaactaccacgatgccgagaagccgtgggcatgcaataaccagctgtacccgacacca
gagcaacagcaccaattcgtcaccgcatacctgacacacaggccagggctaggcagccgc
gtctccccttcgataacacccataatgcgccccctttccgcaagcacgcccacaatgaca
ccgctggacctcaacgcaaccagccccgaccttgcaccccagcggccgccagataacatc
gagcgcagtgcacaggacactctagaagcggagacccagttcctcatccgccaaacacga
ctttggcgcgttctcaactcagcgcagtgggtggcttggggtatcgttcaggccaaggtc
cccggaatggaagacgacggaagctcgactcctacgccgccagtagacagcgatgtcgac
gagtcagatgagtttgattatctcgcgtacgcgcaggaccgagctttcttcttctgggcg
gatctagtcgctctaggatttgtgcagaaggaacagcttccagagtcgttggctgaggtt
gttgacgggaggatacttgagtactaa

DBGET integrated database retrieval system