KEGG   Aspergillus nidulans: AN1170.2Help
Entry
AN1170.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ani  Aspergillus nidulans
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AN1170.2
Enzymes [BR:ani01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AN1170.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 523 aa AA seqDB search
MLVDLTIDSDPEEQPRIPNPLIKSLGRQTLAHRTLSPSPHTKNSTIPFKRKSDADSAESG
SESSYASAVAYPQKAKTRTTNVSSRNPVGHDSLSGPFKRVGAGPGTGAARQARQIPASAP
SLASSSGTDSAAGHYAPSPAPETLRVVIPSPSVQLKKEIDSAERLPDAEVKTPEITGMSE
KYYPTDALERRAMRGAYPAARKTNRAGVPLVIGTPGPFLTEKNRRPVIDLLCKNLQKKLA
SIKGPAVTVAKADEKRLAKATTGFEFINEYKLREGVAPISKEFQSGCSCETICLPDRCQC
LAQEEDSEERIIAYKRARDNPRFMVLRPEFMKRTSMIFECNSLCGCEEKCWNRVVQLGRT
IRLEIFHTGARGFGLRSLDTIRAGQFIDLYLGEVITTSKADQREKIANTRNAPSYLFSLD
FLVDDESSYVVDGANYGAATRFINHSCNPNCRMFPVSRTHGDDYLYDLAFFALREIKPGT
ELTFDYNPGMERVDKLDPNAVPCLCGEPNCRGQLWATERKKAR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctggttgacctcacgatagactctgatccagaggagcaaccccggattcctaaccct
cttatcaaaagtcttgggcggcagacacttgcacaccgcactctttctccctctcctcac
accaagaactctacaattcctttcaagagaaagtcagatgcagactccgccgagtccggc
tcagagtcttcatacgcaagtgcagttgcgtaccctcaaaaagcaaagaccagaaccacc
aatgtttcctctcgaaacccagttggccatgatagcctgtccgggccctttaagagagtt
ggtgccggccctggtactggtgctgcgcgtcaggcacgccaaatcccagcatcagctcca
tctctagcttcaagttcaggcacagactcagccgcaggccattatgccccaagcccagcg
ccggagaccctgagagtagtcattccatctccatcagtacagctaaagaaagagattgat
tctgccgagcggctcccggatgcagaagtcaagactcccgagattacgggtatgtcggag
aaatactacccaacagatgctcttgaaaggcgcgcaatgaggggtgcatatccagctgct
aggaaaaccaatcgcgctggtgtccctttagtcattggcacaccaggcccctttttaact
gagaagaatagacgccccgtgatagacttgctctgcaagaatctccagaagaaactagcc
tccatcaaaggtccagcagtgactgtggccaaagcggacgagaagcgtctcgccaaagct
accacaggcttcgagttcatcaacgagtacaagctccgagagggcgtagcacctatcagc
aaggaattccaatccggctgtagctgcgagactatctgcctaccagatagatgccagtgt
cttgcacaagaagaggactcggaagaacgtatcattgcatacaagcgtgcccgagacaat
ccgcgcttcatggtccttcggcctgagttcatgaagcgcacatccatgatcttcgaatgc
aattctctgtgcgggtgtgaggagaaatgctggaatcgcgtcgtccagttgggacgcact
atccgcctggagattttccacactggagcgcgtggctttggcctccgttcgcttgatacc
atccgcgctggccaattcatagatctatatcttggtgaagtaatcacaacctccaaggcc
gaccagcgcgaaaaaatcgccaacacgcgtaacgccccttcctatctctttagtctcgac
ttccttgttgatgacgaaagcagttacgttgttgacggggcgaactatggtgccgccacc
cgcttcatcaaccactcctgcaaccccaactgccgtatgtttcccgtctcccgtacccac
ggcgatgactacctttatgatttggcgttcttcgcattaagagaaatcaaacccggcaca
gaattgaccttcgactataaccccggaatggagagggttgataagctggatccgaatgcg
gtgccttgtctttgcggcgagccaaattgtcgcgggcagctgtgggctactgagaggaag
aaagcaaggtag

DBGET integrated database retrieval system