KEGG   Aspergillus nidulans: AN1176.2Help
Entry
AN1176.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ani  Aspergillus nidulans
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ani00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 499 aa AA seqDB search
MAFNSSPCTNQSDSHLRLLGHDSTLMVGQSVSLTLGGDSLLIVDERVMRKSDRTCCGMVP
KPTNKVTHSISLYNVLDTSVSSAGLTITYAEPAGKDDIAVTALQYPIAAEEKSRVEQWMS
KLLALAYGNAQRYKRLKVLINPFGGKGHAAKMYRTYAEPVFAAAHCELDVQETTHGGHAT
EIAEQIDVNAFDAIVCCSGDGLPYEVFNGLARKPNAGEALRKLAVAMLPCGSGNAMAWNL
CGTGSVSIAALTIIKGVRMPIDLMSVTQGSTRTLSFLSQSFGIIADSDLGTEHIRWMGAH
RFTYGFLMRLMSRAIYPCDLAIKVVMDDKSSIKHHYNAYVNSPPPDPSRQDSEYTEGLPK
LEYGTVLDELPKDWAVVPADTIGNFFAGNMAIVSKDTNFFPASVPNDGLMDIVTIDGKTP
RTRILKMMSEVPEGTFFDMPEVEIRKALAFRLTPREKEGYISVDGEKIPFEAFQVEIHKG
LGTVLSKTGHLYEAAGPRP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaatagctctccctgcacgaatcagtccgattctcaccttcgtttactcggt
catgattcgactttgatggtgggacaatcagtgtccctcacattgggtggcgactcactt
cttattgtcgatgagcgcgtcatgcgcaaatcggaccgcacatgttgtggaatggtcccc
aaacctacgaacaaggtcacacactccatctctctgtataacgtgctcgataccagcgta
tcgtcagctggcctgaccattacctacgccgagcccgcaggcaaagatgacatcgccgtt
accgctctgcaataccccatcgccgctgaagagaaatcgagggtcgagcaatggatgtca
aaactactagctcttgcatacggcaatgcgcagcgttataagcgacttaaagtcctgatc
aacccgtttggcggcaagggacatgcggctaaaatgtatcgaacatacgcggagcctgtc
tttgcggctgcacactgtgagctggatgtgcaagaaacgacacatgggggacatgccact
gagattgcagagcaaatcgatgtcaatgcgtttgacgccattgtatgctgctcaggggat
gggctaccgtatgaagtcttcaacgggctcgcgaggaagccgaacgccggggaagccctt
agaaagctagccgttgccatgttaccgtgcggttcggggaatgcaatggcctggaatctt
tgcggaacgggcagcgtttccatcgcagctctgaccatcatcaagggagtgcgcatgccc
atcgatctcatgtccgttacgcagggaagcactcgcactctgtccttcttatcacagtct
ttcggcatcatcgcagactcagatctgggcacggaacacattcgctggatgggggctcac
cgctttacctacggctttttaatgcgccttatgtcccgagcaatatacccttgtgacctt
gctataaaagtggtaatggacgacaaaagctctataaagcatcattataatgcatatgtg
aacagccccccaccagatccctcgcgtcaggactccgaatacaccgaaggtcttcccaag
cttgagtatggaaccgttctcgatgagcttcccaaagactgggccgtcgtaccagcagac
acaattggcaacttctttgcgggaaacatggccatagtatcgaaggataccaacttcttc
ccggcgtccgtgcccaacgatggccttatggacatcgtcacaattgacggaaaaactcct
cgtacccgcatcttgaaaatgatgtccgaagtcccggagggcacattcttcgatatgccg
gaagtcgagatccgcaaggcactcgctttccgactcaccccaagggaaaaagaggggtat
atcagcgtcgatggagaaaaaatccccttcgaagctttccaggtcgaaatccacaagggt
ctaggcacagtcctctccaagactggccacctatatgaagcggctggcccaaggccttga

DBGET integrated database retrieval system