KEGG   Aspergillus nidulans: AN1285.2Help
Entry
AN1285.2          CDS       T01016                                 

Definition
similar to endo-beta-1,4-glucanase A
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ani  Aspergillus nidulans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ani00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 326 aa AA seqDB search
MRSLVLLSSVLALVAPSKGAFTWLGTNEAGAEFGEGSYPGELGTEYIWPDLGTIGTLRNE
GMNIFRVAFSMERLVPDSLAGPVADEYFQDLVETVNGITALGAYAVLDPHNYGRYYGNII
TSTDDFAAFWTILATEFASNELVIFDTNNEYHTMDQSLVLNLNQAAIDAIRASGATSQYI
FAEGNSWTGAWTWVDVNDNMKALTDPQDKLIYEMHQYLDSDGSGTNTACVSSTIGSERVT
AATNWLRENGKLGVLGEFAGANNQVCKDAVADLLEYLEENSDVWLGALWWAAGPWWGDYM
FNMEPTSGIAYQEYSEILQPYFVGSQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctctcgtccttctgtcgtccgtcctggccctggtggcaccctccaaaggcgcc
ttcacatggcttggtaccaacgaagccggtgccgaattcggcgagggctcctaccccggc
gaactgggcacggaatacatttggcctgacctgggtacgattggtacgctgaggaacgag
gggatgaacatattccgcgttgcgttctccatggagcgcctggtgcctgattcgttggct
ggaccggtagcggacgagtattttcaggacttggtcgagacggtcaacggcattacggcc
ctgggtgcgtatgcagtccttgacccgcataattatggacggtactacggcaacattatc
acttcaaccgatgactttgcagccttctggaccatccttgccaccgagttcgcttctaat
gagcttgtcatcttcgataccaataatgaataccacaccatggaccagtcccttgtcctg
aacctcaatcaggcggccatagacgctattcgcgcctccggtgccaccagccaatatatc
ttcgcggaaggaaactcttggactggagcctggacctgggtggatgtcaacgacaacatg
aaagcgctcaccgatccccaagataagctcatctacgagatgcaccagtatcttgactcc
gacggctctgggacgaacacggcctgcgtcagttctactatcggcagcgaacgcgtgaca
gccgctacaaactggctgcgagagaacgggaaactgggggtgctcggtgagtttgcaggc
gcaaacaaccaggtctgcaaggacgcagtcgcagatctgctggagtatcttgaggaaaac
agtgatgtatggcttggggccctttggtgggctgctgggccttggtggggtgattatatg
ttcaacatggagcctacttcgggtattgcataccaggagtactcggaaatcttgcagccg
tatttcgtgggaagtcaataa

DBGET integrated database retrieval system