KEGG   Aspergillus nidulans: AN1379.2Help
Entry
AN1379.2          CDS       T01016                                 

Definition
similar to SONA
Orthology
K14298  
mRNA export factor
Organism
ani  Aspergillus nidulans
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ani03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 362 aa AA seqDB search
MSGLFGATANTSTAASNTTGDISKDVALNSPPEDSISDLRFSPASEHLAVASWDKKVRIY
EINEQGQSEGKALFEHEAPVLNCCWSPDGTKVVGAGADKAARMLDLAANATAPIQVAAHD
APIRCCHMIPNPAGGTPLLVTGSWDKQVKYWDLRQSTPIASLECQERVYTMDVKDKLLVI
GTADRYINIVDLNNPTKFYKTMQSPLKWQTRVVSCFTDANGFAVGSIEGRCAIQYVEDKD
SSSNFSFKCHRETPPNQRDINNIYSVNAISFHPVHGTFSTAGADGTFHFWDKDAKHRLKG
YPSVGGTISSTAFNRTGNIFAYAVSYDWSKGYSANTPQLPNKVMLHPVAQEEVKPRQNAR
RR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggctctttggcgccacggcgaacacctcaacagctgcaagcaacaccaccggg
gacatctcgaaggacgtcgctctcaactccccacccgaggacagtatctcagatctacgt
ttttctcctgcgagtgaacatctggccgtagcgtcgtgggacaagaaagtccgcatctac
gaaatcaacgagcagggtcagagtgaggggaaagctctttttgagcatgaggcccccgtc
ttgaactgctgctggtcacctgacgggacaaaggtcgtcggagcgggtgcagacaaggcg
gctcgtatgctcgatctcgctgccaatgctactgcgcctattcaggtcgccgctcacgac
gccccgatcagatgttgccacatgatcccaaatccggccggtggcacgcctctcctcgtg
acgggctcctgggacaaacaggtcaaatactgggatttacggcagtcaactcctatcgct
tcgttagagtgtcaggaacgtgtttacacgatggatgtcaaggataaactgctagttatt
gggacggcggaccggtacatcaatatagtcgacctcaataaccccacaaaattctacaaa
accatgcagtcacctctgaaatggcaaactcgggtggttagctgcttcacagacgcaaat
ggttttgccgttggaagtatcgaaggccgctgtgctatacagtacgtcgaagacaaggat
tcgagctcaaacttcagttttaaatgccatcgcgaaacaccgcccaaccagcgtgatatc
aacaacatctactcggtcaacgccatttctttccaccccgttcacggtaccttcagtacg
gccggtgcagatggcacttttcacttctgggataaggatgccaaacatcgtcttaaggga
tatcccagcgtcgggggcacaatttcaagtactgccttcaatcgcacaggcaacatattc
gcctatgccgtgagctacgactggagcaagggttactcggcgaacaccccacagcttccc
aacaaagtcatgcttcatccggttgcgcaggaagaagtgaagccaaggcagaacgctagg
aggcgataa

DBGET integrated database retrieval system