KEGG   Aspergillus nidulans: AN1403.2Help
Entry
AN1403.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ani  Aspergillus nidulans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AN1403.2
Enzymes [BR:ani01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AN1403.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN1403.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII
AA seq 373 aa AA seqDB search
MSFSNLVSDLALRDSYEDRNSQISNARSQVTARSYTSTAATSVSIAGDISSQLHSGYSHP
LSRSWQAERQLTKEMLIYPLFITDNPDEETPIPSLPNQHRRGLNRLVPFLRPLVQKGLRS
VILFGVPLHPSAKDALGTSADDPAGPVVQAIRLLRSRFPELYIVTDVCICEYTSHGHCGI
LREDGTLDNAQSVDRISDVALAYASAGAHCVAPSDMNDGRVRAIKLKLIEAGLAHRVLLM
SYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGRGLARRAIQRDIGEGADIIMVKPA
SSYLDIIRDAKELAKDIPIAAYQVSGEYAMIHAGAKAGVFDLKSMAFESTEGILRAGAGI
IVSYFVPEFLDWL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttcaaatctcgtctccgacctcgcgttgagagacagctatgaagaccgaaac
tcccagatctcgaatgcacggtctcaagttaccgctcgatcatacacaagtacagctgcc
acaagtgtcagcatagccggagacatctcaagccagctacattctggctacagccatcca
ctcagcaggtcatggcaagcagagaggcaattgaccaaggaaatgttaatctaccccctt
ttcatcaccgacaacccggatgaagagacgcctattccgtcactcccaaatcaacaccgt
cgaggattgaatcggctcgtaccattcctgcggccccttgttcagaagggtctccgctct
gttatcctgtttggtgttccgctgcatccatctgccaaggatgcattgggaacctccgcg
gacgacccagccggccccgtcgtacaggccattcgtcttctccgctcgcgctttccagaa
ctttacatcgtgactgacgtttgcatatgtgaatacacatctcatggccactgcggaatt
ctgcgggaggacggtacgctcgataatgcgcagtccgttgaccgaatatcggatgttgcg
ttggcttatgctagcgctggtgcgcactgcgtcgcgccatctgacatgaacgatgggaga
gttcgcgccataaaattgaaactaattgaggctggtctggctcatcgtgtgctgttaatg
tcttatagtgctaaatttagcggctgcctttatggaccgttcagggacgcggctggttct
tgcccttcatttggagaccgcagatgctaccagcttccccctggtggccgcgggcttgca
cggagagctattcaaagggacatcggcgagggtgcggatatcattatggtaaagccagca
agcagctatcttgatatcattagagacgcaaaagaacttgcgaaggatattccaattgcg
gcttatcaagttagtggcgaatatgccatgatacatgctggagcaaaggctggagtcttc
gatctgaaatcaatggcttttgagagtaccgaaggaattttacgagctggcgctgggata
atagtcagctattttgtgccagaatttttagattggctctaa

DBGET integrated database retrieval system