KEGG   Aspergillus nidulans: AN1416.2Help
Entry
AN1416.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ani  Aspergillus nidulans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AN1416.2
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AN1416.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AN1416.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 923 aa AA seqDB search
MAPKEDALPPGWDDLDRQMGQLFMMGFDGTTVSPQIRSLIQKYHIGSVLLTAKNLKSAED
ATRLILELQTIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKDLAH
DIAFATAQELKAVGFNWILGPVLDVLTNVRNQLMGVRTCGDDPQEVSQYGVEFMKGYQQA
GLSTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIMNGLDAMMVGGVSM
SSAGVNVMHACLSEQVVDDLLRKDMKFDGVVVSECLEMEALTHNIGVGGGTVMAKNAGCD
IILLCRSFQVQQEAINGMKLGVENGIINRTRIEESLRRVLAMKGRCTSWEQALNPGGLPS
LTQMQPSHTSLSTRAYSNSISVVRDNRNLLPLTNVLSSNEELLLLTPLVNPLPASAVSRS
VTEHLELSADAVAWDRTASVLSGESVFKELGRSLSRHRNGRVLHTSYTSNGVRPIHESLI
DRASAVIVITADAVRNIYQQGFTKHVSMICKSQLTPSGEPLDKPLVVVAVSSPYDFAMDA
SIGTYLCTYDFTDTALETLVKVLYGELTPTGSLPGSFNRSQKLHQARQHWLVENWNEERD
SDALDALLKTMGPELSGVTPSSFLLRRDDIDEAHFVVRNSTTRALYGFCSTYYFRATGTG
VIGSLIVDPSRRRLSIGNSLHNRAIRTLMQRKGMKRFQLGSRLPGIYLGIPAANPVERKK
RRQWFANLGWNTALSRPVCNVALRNLQTWSPPEGLVNSLQSADAVYDLVHGWDYADSIID
HVKTNSRQGVIDIYKIALGGAPHCGIIRARRPHDGAILGSVVIYNMQATLAEHMPATKAM
HVPTGGISSPVIWPSVGEYATLLQGLILLGIKQIRRQGADAVVIDCVDVDSNFDWLTEIG
FTTLHSYEEVNCDAATWTMVPGP
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaaagaggatgcgctgccccctggctgggatgatcttgacaggcagatgggg
cagcttttcatgatgggcttcgatggaacgacggtcagccctcagattcgttctctcatc
cagaagtatcacataggttcagtcttgttaaccgctaagaatttgaaatctgcagaggac
gcaacccggctaattctggagctgcaaacaattgctcgcgatgccggccatcctgtgccg
ttacttatagctctggaccaagagaatggtggagttaacagcttatatgacgagatttat
attcgacagtttccaagtgcaatgggtattgcggctacggggtcaaaagacttggcccat
gacattgcttttgctacggctcaagagctcaaagccgtcgggttcaattggatcctaggg
cctgtgctggacgtattgacgaatgtacggaatcaattgatgggcgtccgcacctgcggt
gatgacccgcaggaggtgtcccagtacggggtagagtttatgaaaggttaccagcaggcc
ggcctatcaacttgcggcaagcattttccttcgtatgggaacctggagtttttagggtct
cagaccgacgtgcccatcatcacggagtctttagaacagctcagtttgaccgcattggtt
ccatttcggaacgctatcatgaatggtcttgacgcgatgatggtgggaggcgtttccatg
tcctccgccggagtcaatgtcatgcatgcttgtctaagcgagcaggttgttgacgacctc
ttacggaaggatatgaaatttgatggagtcgtggtttcggaatgtctggagatggaggcg
ctcacccataacattggcgtaggaggcgggacagtgatggccaaaaacgccggctgcgat
ataatactattgtgcaggtcttttcaggtgcaacaagaagccatcaacggaatgaagctt
ggtgtggagaacggcattatcaaccggacacgaatagaggaatcgctacggagagtgttg
gccatgaaggggagatgcacttcctgggaacaggctcttaaccctggggggctgccttcg
ctcactcaaatgcagccatcgcatacgagtctctcaacaagagcttacagcaattccatc
tcagtcgtgcgcgataacagaaacctgttaccgctgaccaatgtcttatcttccaacgag
gagctgcttcttctgacaccgttagtaaatcctttgcctgcctccgccgtatctcgctca
gtgactgagcatctggagctgtcggcggatgcggtagcctgggataggacggcttccgta
ctcagtggcgagagcgtctttaaggaattggggagatcgctttcgcgtcaccgaaacggt
cgtgttctgcatacgtcctacacctcgaatggcgtccgtccgatccacgagagtttaatt
gaccgtgccagtgccgtgattgtcatcaccgcagatgctgtcaggaacatttaccagcaa
ggttttacaaaacatgtgtctatgatttgtaagtcgcagttgactccatcaggcgaacca
ctcgataagccattagttgttgttgccgttagttcaccttatgatttcgccatggatgca
agcattgggacttacctttgcacatacgatttcacggacacggccctggaaaccttggtc
aaggttctttatggagagctgacgcctacggggtcattgccgggttctttcaatcgcagt
cagaagctccaccaggcaagacaacattggcttgtggaaaactggaacgaggagagagat
tccgatgcattggacgcgcttctgaagacgatgggtccggaactctctggtgtgacgccc
agtagctttcttctgcggagagacgacattgacgaggctcactttgttgtccgaaacagc
accactcgggccctctacggcttctgttcaacctactacttccgggccactggcacgggg
gtcatcggatcattgattgtcgacccatcgcggcgcaggctctcgattgggaattccctc
cacaaccgcgctatccgaacgcttatgcaacgaaaagggatgaagcggtttcaactgggg
tcccgtcttccagggatttacctgggcatacccgccgctaaccctgtcgaaagaaagaaa
cggcggcagtggttcgcaaatctgggctggaacaccgccctctcccgccctgtctgcaat
gtcgctctccgcaacttgcaaacttggtctccgcctgagggcctagtcaacagcctacag
agcgcagacgcggtttacgatcttgtccacggatgggactatgctgactcgatcattgac
catgtcaagaccaactccagacaaggagtaattgacatatacaaaattgccttgggcgga
gcaccgcattgcggcattatcagggcaagaagaccacacgacggggctattctcggcagc
gtggttatctataacatgcaggcgacgctggcggagcacatgcccgctacgaaggccatg
catgtgcccacagggggaatttcgtcccccgtaatatggccttcggtcggagaatacgca
acacttttgcaggggttgatcctattaggaatcaagcagatacggagacagggcgctgat
gcagttgttatagattgtgtggatgtcgacagcaactttgactggcttacagagatagga
ttcaccactttgcatagctatgaagaagtcaactgtgacgcggcgacgtggacaatggtg
cctgggccttga

DBGET integrated database retrieval system