KEGG   Aspergillus nidulans: AN1502.2Help
Entry
AN1502.2          CDS       T01016                                 

Definition
similar to N-acetylglucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ani  Aspergillus nidulans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ani00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:ani00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ani00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ani00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 603 aa AA seqDB search
MAYFRLYAVLLAVASSVAAVKVNPLPAPRHISWGHSGPKPLSDVSLRTERDTDDSILTNA
WNRAWETIVSLEWVPAGIEAPIPEFDEFPTSTPSASAAATRSKRANVPIQFVDVDVEDWD
ADLQHGVDESYTLDAKAGSDAIDITAKTVWGALHAFTTLQQLVISDGNGGLILEQPVHIK
DAPLYPYRGLMVDTGRNFISVRKLHEQLDGMALSKLNVLHWHLDDTQSWPVHIDAYPEMT
KDAYSARETYSHDDLRNVVAYARARGIRVIPEIDMPAHSASGWQQVDPDIVACANSWWSN
DNWPLHTAVQPNPGQLDIINPKTYEVVQDVYEELSSIFTDDWFHVGGDEIQPNCYNFSTY
VTEWFQEDPSRTYNDLMQHWVDKAVPIFRSVSDSRRLVMWEDVVLNTEHADDVPTDIVMQ
SWNNGLENINKLTERGYDVIVSSADFMYLDCGRGGYVTNDDRYNEQTNPDPDTPSFNYGG
IGGSWCGPYKTWQRIYNYDFTLNLTNAQAKHVIGATAPLWSEQVDDVNISNLFWPRAAAL
AELVWSGNRDAKGNKRTTLFTQRILNFREYLLANGVMAATVVPKYCLQHPHACDLNYDQT
VLH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcctacttccgcctctacgccgtgttgcttgccgtggcgtcctcggtcgccgccgtc
aaggtcaatcctctaccagctccacgccacatttcctggggtcattcaggcccaaaaccg
ctatcggatgtcagtttgcgcactgaacgagatactgacgatagtatccttacgaatgcg
tggaatcgcgcttgggaaactattgtttctctagaatgggtccctgccggaattgaagca
cccattccagaattcgatgagttcccaacttcaaccccatctgccagtgccgctgctact
agaagcaagcgcgccaatgtgcctattcagttcgtcgatgttgatgtggaagattgggac
gccgatctacagcacggggtggacgaatcttacactctagacgccaaggctggttcggac
gcgattgatatcactgcgaagacggtctggggcgcccttcacgctttcactacgctccaa
caattggtcatctcagacggaaacgggggtctgattcttgagcagcccgtccacatcaaa
gatgcgcctctctacccatatcgcggacttatggttgatactgggaggaacttcatctct
gtccgcaagctacacgagcagctcgatggcatggcactgtcgaagctcaatgtccttcac
tggcatctggacgatacccaatcatggccggtgcacattgatgcttacccggagatgacc
aaggacgcatactccgcgcgcgagacttactcccatgatgacctgcgcaatgttgtggcg
tacgcgcgcgcccgtggaatccgtgtgatcccggaaattgatatgcccgcccactctgcc
tctggttggcaacaggttgaccccgatattgtagcctgcgccaattcctggtggtccaac
gacaactggccgttgcatactgcagtccagccgaacccaggacagctcgatatcatcaat
cccaagacgtacgaagtcgttcaagacgtgtacgaagagctatcaagcatcttcaccgat
gactggttccatgttggtggcgacgagattcagcccaactgctacaacttcagcacctac
gtgactgaatggttccaagaggacccctcgcgcacttacaacgacctcatgcagcactgg
gtcgacaaggccgtgcctatcttccgcagcgtcagcgactcccgccgcctagttatgtgg
gaagacgtcgtcctcaataccgagcatgctgacgacgtcccgacagacatcgtcatgcaa
agctggaacaacggcctcgaaaacatcaacaagctcaccgaacgcggctatgatgtgatc
gtctcctccgcggacttcatgtacctcgactgcggccgcggaggctacgtcaccaacgac
gacagatacaacgagcagaccaacccagaccctgacaccccgagtttcaactatggcggc
attggcggctcctggtgcggcccgtacaagacatggcaacgcatctacaactacgatttt
accctcaacctcacaaatgcccaagcaaagcacgtcatcggcgcaacagcaccgctctgg
tccgagcaggttgacgatgtcaacatctccaacctgttttggcctcgggctgcagctctc
gctgaactcgtgtggtcaggcaaccgcgatgcaaaggggaacaaacgcaccactctcttc
acccaacgaatcctcaacttccgcgagtatcttcttgccaacggcgttatggctgctact
gtcgttccgaagtattgcctgcagcacccgcatgcttgtgatttaaattatgaccagaca
gtccttcactag

DBGET integrated database retrieval system