KEGG   Aspergillus nidulans: AN1502.2Help
Entry
AN1502.2          CDS       T01016                                 

Definition
similar to N-acetylglucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ani  Aspergillus nidulans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AN1502.2
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AN1502.2
   00603 Glycosphingolipid biosynthesis - globo series
    AN1502.2
   00604 Glycosphingolipid biosynthesis - ganglio series
    AN1502.2
   00511 Other glycan degradation
    AN1502.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AN1502.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 603 aa AA seqDB search
MAYFRLYAVLLAVASSVAAVKVNPLPAPRHISWGHSGPKPLSDVSLRTERDTDDSILTNA
WNRAWETIVSLEWVPAGIEAPIPEFDEFPTSTPSASAAATRSKRANVPIQFVDVDVEDWD
ADLQHGVDESYTLDAKAGSDAIDITAKTVWGALHAFTTLQQLVISDGNGGLILEQPVHIK
DAPLYPYRGLMVDTGRNFISVRKLHEQLDGMALSKLNVLHWHLDDTQSWPVHIDAYPEMT
KDAYSARETYSHDDLRNVVAYARARGIRVIPEIDMPAHSASGWQQVDPDIVACANSWWSN
DNWPLHTAVQPNPGQLDIINPKTYEVVQDVYEELSSIFTDDWFHVGGDEIQPNCYNFSTY
VTEWFQEDPSRTYNDLMQHWVDKAVPIFRSVSDSRRLVMWEDVVLNTEHADDVPTDIVMQ
SWNNGLENINKLTERGYDVIVSSADFMYLDCGRGGYVTNDDRYNEQTNPDPDTPSFNYGG
IGGSWCGPYKTWQRIYNYDFTLNLTNAQAKHVIGATAPLWSEQVDDVNISNLFWPRAAAL
AELVWSGNRDAKGNKRTTLFTQRILNFREYLLANGVMAATVVPKYCLQHPHACDLNYDQT
VLH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcctacttccgcctctacgccgtgttgcttgccgtggcgtcctcggtcgccgccgtc
aaggtcaatcctctaccagctccacgccacatttcctggggtcattcaggcccaaaaccg
ctatcggatgtcagtttgcgcactgaacgagatactgacgatagtatccttacgaatgcg
tggaatcgcgcttgggaaactattgtttctctagaatgggtccctgccggaattgaagca
cccattccagaattcgatgagttcccaacttcaaccccatctgccagtgccgctgctact
agaagcaagcgcgccaatgtgcctattcagttcgtcgatgttgatgtggaagattgggac
gccgatctacagcacggggtggacgaatcttacactctagacgccaaggctggttcggac
gcgattgatatcactgcgaagacggtctggggcgcccttcacgctttcactacgctccaa
caattggtcatctcagacggaaacgggggtctgattcttgagcagcccgtccacatcaaa
gatgcgcctctctacccatatcgcggacttatggttgatactgggaggaacttcatctct
gtccgcaagctacacgagcagctcgatggcatggcactgtcgaagctcaatgtccttcac
tggcatctggacgatacccaatcatggccggtgcacattgatgcttacccggagatgacc
aaggacgcatactccgcgcgcgagacttactcccatgatgacctgcgcaatgttgtggcg
tacgcgcgcgcccgtggaatccgtgtgatcccggaaattgatatgcccgcccactctgcc
tctggttggcaacaggttgaccccgatattgtagcctgcgccaattcctggtggtccaac
gacaactggccgttgcatactgcagtccagccgaacccaggacagctcgatatcatcaat
cccaagacgtacgaagtcgttcaagacgtgtacgaagagctatcaagcatcttcaccgat
gactggttccatgttggtggcgacgagattcagcccaactgctacaacttcagcacctac
gtgactgaatggttccaagaggacccctcgcgcacttacaacgacctcatgcagcactgg
gtcgacaaggccgtgcctatcttccgcagcgtcagcgactcccgccgcctagttatgtgg
gaagacgtcgtcctcaataccgagcatgctgacgacgtcccgacagacatcgtcatgcaa
agctggaacaacggcctcgaaaacatcaacaagctcaccgaacgcggctatgatgtgatc
gtctcctccgcggacttcatgtacctcgactgcggccgcggaggctacgtcaccaacgac
gacagatacaacgagcagaccaacccagaccctgacaccccgagtttcaactatggcggc
attggcggctcctggtgcggcccgtacaagacatggcaacgcatctacaactacgatttt
accctcaacctcacaaatgcccaagcaaagcacgtcatcggcgcaacagcaccgctctgg
tccgagcaggttgacgatgtcaacatctccaacctgttttggcctcgggctgcagctctc
gctgaactcgtgtggtcaggcaaccgcgatgcaaaggggaacaaacgcaccactctcttc
acccaacgaatcctcaacttccgcgagtatcttcttgccaacggcgttatggctgctact
gtcgttccgaagtattgcctgcagcacccgcatgcttgtgatttaaattatgaccagaca
gtccttcactag

DBGET integrated database retrieval system