KEGG   Aspergillus nidulans: AN1630.2Help
Entry
AN1630.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AN1630.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 544 aa AA seqDB search
MASAARSASRAFLRSSLRPAVRSSRFALPTQGLRVASRRGYSSEASSGKSSNTLLWAGVA
LAGGAGAYFYLQGGDVGASTKVFTPTKEDYQKVYNAIAERLANETDYDDGSYGPVLVRLA
WHASGTYDAETGTGGSNGATMRFAPESDHGANAGLKYARDFLEPIKAKFPWITYSDLWTL
AGACAIQELGGPDIPWRPGRQDKDVSGCTPDGRLPDATKNQDHIRAIFGRMGFDDREMVA
LIGAHALGRAHTDRSGFDGPWNFSPTVFTNEFFRLLVEEKWQPRKWNGPKQFTDNTTKTL
MMFPTDLALVQDKGFRKHVERYAKDSDAFFKEFSEVFVKLLELGVPFNSKVEDRYVFKRI
ISAPTTTPSFYEILNLPFPSTGLSKQQLKIAYHKALLKHHPDKAVAVAKENLPSSNHGPA
QPPSNQKITIDAITTAYKTLSDPVQRAEYDRVLRLDRNRVNGAGDKNGNGTVFHTGLEVV
DLEDLDCDEGGDEAMWYMACRCGDERGFSLSESDLEREADSGEIVVGCRGCSLYTKVLFA
VQDD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgctgctcgatccgcatcacgcgccttcttgcgctcttccctcagaccagct
gtccgcagctcccggtttgctcttcctactcaaggcctccgcgttgcttctcgccgtgga
tactcttccgaggcgagctccgggaagtcttctaacaccctcctgtgggccggtgttgct
ctcgcaggtggtgccggtgcatacttctacctccagggcggcgatgttggcgctagcacc
aaggtcttcactcctacaaaggaagactaccagaaggtgtataatgccattgccgagcgt
ctcgccaacgaaaccgactacgatgatggcagctatggacctgtccttgtccgtctagcc
tggcacgcaagcggcacctacgacgcagaaaccggtactggtggcagcaacggcgcgacc
atgcgtttcgcccccgagtctgaccacggcgccaacgccggtctcaagtacgcccgtgac
ttcctcgagcccatcaaggccaaattcccctggatcacctactccgacttgtggacactt
gcgggagcctgcgcgatccaggaactcggcggcccagacatcccctggcgccctggccgc
caggacaaggacgtttctggctgcacacctgacggccgtcttcctgacgcgaccaagaac
caagaccacatccgtgccattttcggacgcatgggtttcgatgaccgcgagatggttgct
ttgatcggtgcacacgctcttggtcgtgctcacacggaccgctctggtttcgatggaccc
tggaacttcagccctaccgtcttcacaaacgagtttttccgcctgttggttgaggagaag
tggcagccgcggaagtggaacggccccaagcagttcactgataacacaaccaagacactg
atgatgttcccgactgacctggcacttgtccaggacaaggggttcaggaagcatgttgag
cggtatgctaaggacagcgacgccttcttcaaggagttctctgaggtctttgtcaagctg
cttgagcttggtgtgcctttcaacagcaaggttgaggaccgatatgtcttcaagaggatt
atttctgcacccacaacgaccccctcattctacgagatactcaacctcccattcccaagc
accggcctctcaaaacagcagctgaaaattgcgtatcacaaagcgctgctgaaacaccac
ccggacaaagccgtcgctgttgcaaaagaaaacctcccctcatccaatcacggccccgcg
caaccaccttcaaaccaaaagattacaatcgacgccattacaaccgcatataagaccctc
tctgatcctgtccagcgtgccgaatacgatcgcgtactccgactagatagaaaccgggtg
aatggggcgggagataagaacgggaacggtacggtctttcacacagggctggaggttgtt
gatctggaagatctggattgtgatgagggcggtgacgaagctatgtggtacatggcgtgc
aggtgtggtgatgagcgagggttttcactttccgagagcgatttggagagggaggcggac
tcgggcgagattgttgttggttgtcgcggctgtagcctctacacaaaggttctatttgcg
gtgcaggatgactga

DBGET integrated database retrieval system