KEGG   Aspergillus nidulans: AN1675.2Help
Entry
AN1675.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ani  Aspergillus nidulans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AN1675.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AN1675.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 628 aa AA seqDB search
MRTSTTVLALAGLLSGAASSEVSPVQRSFPNAPDGYTPANVSCPSNRPEIRLATGLSPNE
TSWLERRRNVTRSALSDFFGHVSVGNFDAVGYLDRIGSNSSNLPNIGIAVSGGGWRALMN
GAGALKAFDSRTDNSTSEGQLGGLLQSATYLSGLSGGGWLVGSIYINNFTTISSLQSNDD
VWQFQNSILEGPDKGGIQILDTAGYYRDLYDAVNGKRDAGYDTSLTDYWGRALSYQLIDA
VRGGSSYTWSSIALGQNFRDAEMPLPILVADGRFPGELLISGNTTVYEFNPWEFGSFDPT
VYGFAPLEYLGSRFINGSIPRNESCVRGFDNAGFVMGTSSSLFNQFFLQLNGTSLPDFLK
DVIGDVLADIGEDDNDIAVYSPNPFYGWLPQNSPYAGEENLDVVDGGEDLQNLPLHPLIQ
PSRHVDVIFAIDSSADVNDWPNGTALVATYERSLNSTGIGNGTEFPAIPDQNTIVNLGLN
TRPTFFGCDSTNTSAPLVVYIANRPFVYQSEETISNFSTFQLSTSLEQRDNSIQNGYAVA
TMGNSTEDSNWSACVGCAILSRSFDRTNEQVPDICTQCFDRYCWNGTLNSTTPAPYYPAA
VLGSGSSKLFPTVLSSVVAASIAIATMV
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaggacttcaactacggtgcttgctttggccggattgctgtccggtgccgcatcgtcc
gaagtgtccccggtgcagcggtcatttcccaatgcccctgacggctacacccctgcgaac
gtgagttgcccgtccaaccgtccagaaatccggcttgcgacgggactttcgccgaacgag
acttcatggctcgagcggcgccgcaatgtcacgcggtcggctctgagtgacttctttggt
catgtcagcgttggaaattttgacgcggtcggttaccttgatcggatcggtagcaactcc
tcgaatctgcccaacattggaatcgcagtctctggcggaggatggcgtgctttgatgaac
ggtgctggagcccttaaggcgttcgatagccggacggacaactcaaccagcgaaggtcaa
ctcggtggcttgctgcaatccgcgacgtacttgtctggccttagcggcggtggctggctt
gttggctccatctatatcaataatttcaccaccatttcgtcgctgcagtcgaacgatgat
gtgtggcaattccagaattccatcctcgaaggccctgacaagggcggtattcagattctt
gacaccgcgggctactacagagatctgtacgatgcggttaacggtaagagagacgctggg
tacgatacatcgctcacggattattggggccgtgcactttcataccagttgatcgacgct
gtacgcggaggctcgagttacacttggtcatccattgccctgggccagaactttcgtgat
gccgagatgccgctgccgattctggttgcggatggtcgtttcccgggtgaactcttgatc
tccggaaatacaacagtctatgaattcaacccctgggaatttggcagctttgatccgact
gtctacggatttgcgccattggaatacttgggttcccgctttatcaatggttccattcca
cgcaatgaaagttgcgttcgtggttttgataatgctggatttgtcatgggcacttcttcc
agtctgttcaaccagttcttccttcaactgaacggcactagccttccagatttcttgaag
gacgtcatcggtgatgttctcgcagatatcggcgaagatgataatgacattgccgtctac
tcccctaacccgttttacggctggttaccacaaaactccccctacgccggcgaggaaaac
ctcgacgtcgtggacggcggggaggatcttcagaacctccctctccacccgttgatccaa
ccttcgcgccacgtcgatgttatcttcgcgattgactcctctgctgatgttaacgactgg
ccgaacggcactgctctcgtcgccacctacgagcgcagtctgaattccaccggtattggc
aacggaactgagttccctgcaattcccgaccagaacaccatcgtcaacctgggattgaac
actcgtccaactttcttcggatgcgacagcactaacacctccgctccgctggtcgtctac
atcgccaatcgccccttcgtctaccagtctgaagaaaccatatccaatttctcgaccttc
cagctcagcacctcactcgaacaaagagacaacagtatccaaaatggctatgctgttgca
acaatgggtaacagcactgaagacagcaactggtctgcttgcgttggctgtgcgatcctc
agccgctcgtttgaccgcaccaacgagcaggttcctgatatctgcacccaatgcttcgac
agatactgctggaatggaaccctcaacagcaccacacctgccccttactaccctgctgcc
gttctgggtagcggctcttccaagcttttcccaacagttttgtcgagtgtcgtggcggcg
agcattgcgattgcgacgatggtataa

DBGET integrated database retrieval system