KEGG   Aspergillus nidulans: AN2211.2Help
Entry
AN2211.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K06634  cyclin H
Organism
ani  Aspergillus nidulans
Pathway
ani03022  Basal transcription factors
ani03420  Nucleotide excision repair
Module
ani_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AN2211.2
  Replication and repair
   03420 Nucleotide excision repair
    AN2211.2
Transcription machinery [BR:ani03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AN2211.2
DNA repair and recombination proteins [BR:ani03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     AN2211.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N
Motif
Other DBs
NCBI-GeneID: 2875348
NCBI-ProteinID: XP_659815
UniProt: Q5BB69 A0A1U8QQP1
Position
VII
AA seq 429 aa AA seqDB search
MIEDDIYRTSSQYRLWSFTEETLRSVRQNTNRLASDRVRVALRRAREARQSANSSAAGTP
NANASDVDSKTSEEKDIECLTPEEEQDLVRYYCEQIIQLGESYKPPLPTIVRATAIQYLR
RFYLTNSPMTYHPKTIMPCALFIATKTDNYYMSLRHFADGVPGDTTAEDIIAPEFLVMQS
LRFTFDVRHPFRGLEGGIMELNAIAQGLGQPAPHLPTQTAEDLRRAILSLPPSPNNPSTS
SSSISDRLARAHHNTREILKSAAQMTDAYFLYTPSQIWLSALSIADQPLAQFYLDTKLPT
PNASETGNEHPLAHLRAKVLQTLTSCATLLQSYKPLASDPEQKKAMRRIGKKLYHCQNPE
KVNLAGQKRVPAAAAAVAASASANPSETATPDSEMERLAKKRKLEAEQQKARDIFGGELV
MERTKERQA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagacgacatctaccgcacttcgtcacagtatcgtctgtggtccttcaccgaa
gagactttacgatctgtgcgacaaaatacaaacagactggctagcgaccgggtacgagtt
gcgctgcgacgagcgcgcgaagctcgacaatccgccaactcatctgctgcaggcacccca
aacgcgaatgccagcgatgtagacagcaagaccagcgaggagaaggatatagagtgtttg
acaccagaggaggagcaggacttggtgcgatattactgcgagcagattatccagttaggg
gagagctacaaacccccattgccgacgatagttagagccactgcaatccaatacctccgc
cgcttctacctcaccaactcgcctatgacctaccatcccaagaccatcatgccatgcgcc
ctcttcatcgccaccaagacggacaactactacatgtccctgcgccatttcgccgacggc
gttcccggcgacacaacagcagaagatatcatcgcgccagagttcctcgttatgcagagt
ctccgcttcaccttcgacgtccggcaccctttccgcggcttagagggtggcatcatggaa
ctcaacgccattgcccaaggtctcggccagccagcaccgcacctcccaacgcaaacagca
gaagacctccgccgcgccatcttatctctcccaccatcaccaaataacccatctacctcg
tcatcttcgatatccgaccgtcttgcccgagcgcaccacaacacccgcgagatcctcaag
tccgccgcccaaatgacagacgcctacttcctctacaccccgtcgcaaatctggctctcg
gcgctgtcgatagccgatcaaccccttgcgcaattctacctcgacacgaaactcccaaca
cccaacgcctcagaaactggaaacgaacacccccttgcccacctccgcgcaaaggtcctc
caaacccttacctcctgcgctacgctcctccagtcctacaaaccgctcgcctcagaccca
gagcagaagaaggccatgcgccggatcgggaagaaactatatcactgccagaatccagag
aaggtaaacctcgccgggcagaagcgggttcctgctgctgctgcggcggtggcggcgtct
gcatctgcgaacccaagcgagactgcgactccggatagtgagatggagaggctggcgaag
aagcggaaattagaggcagagcagcagaaggcgagagatatttttgggggggagttggtt
atggagaggacgaaggagagacaggcgtag

DBGET integrated database retrieval system