KEGG   Aspergillus nidulans: AN2294.2Help
Entry
AN2294.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ani  Aspergillus nidulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 574 aa AA seqDB search
MATTTMTAPPPIKTKNSKLPPENERFMRACSDIANALIQEYESQKDPTQPKRDINLNKLR
GQMAKKHSLSHQPPLTAIISAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMSKPHRCPHI
AYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVEQIRSLGHSV
DKVEYIIMGGTFMSLPAEYRDTFVAQLHNALSGYQTDNVDEAVQAGEMSNIKCVGITIET
RPDYCLDTHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAGFKVV
SHMMPDLPNVGMERDLFQFEEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKNYTP
NALIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDVR
TREVGINEVKNKIRPSQVELIRRDYTANGGWETFLAYEDPKQDILIGLLRLRKCSPTHTF
RPEFTGQQTSIIRELHVYGSAVPLHGRDPRKFQHLGFGTLLMEEAERIAREEHGSTKISV
ISGVGVRSYYARLGYSLDGPYMSKMLEPIEGGES
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacgaccatgaccgccccgccaccgatcaagacgaagaattccaagctgcca
ccagaaaatgaacgatttatgagggcgtgttctgacattgcgaatgctctgatacaagaa
tatgaatcgcaaaaagacccaacgcaacccaagagggatatcaacctcaacaaactccgg
ggtcagatggcaaaaaagcatagcttgagccatcagccgccgctgacggccatcatctct
gccgttcctgaacactacaagaaatatatcctgccaaagttgattgcgaagccaatcaga
acgtcctctggtatcgccgttgttgctgtgatgagcaaaccccaccgctgcccacacatt
gcctatacaggaaacatctgtgtctattgccccggcggccctgattccgacttcgagtat
tctacccaatcctataccggatatgaacctacgtcgatgcgagcaatccgcgcacgttat
gatccgtttgagcaggcaaggggacgagtggaacagatcagatccttgggccatagcgtc
gacaaggtcgagtacatcattatgggagggacattcatgtctctgcctgcagagtatcgg
gatacctttgtcgctcagcttcacaatgcgctcagcggttatcagactgataatgtggac
gaagcagttcaggctggagaaatgagtaatataaagtgtgtgggaataactattgagact
cgtcccgattactgtttggacacgcatttgagtagcatgcttcgctacggatgcacgaga
cttgaaatcggtgttcagagcttgtacgaggatgttgcacgagacacaaaccgcggccac
acggttgctgcagttgcggaaacatttaagcttgcgaaggatgcgggctttaaggtggtt
agccacatgatgccagacttgccaaatgtcggcatggaacgtgacttgtttcagttcgaa
gagtattttgagaacccggcttttcgaaccgacgggctgaagatataccccacacttgtc
attcgcggaaccggtctgtacgaactttggaggacaggccgctacaagaactacacccct
aatgcgcttatcgaccttgttgctcgtatcctcgcactcgtccccccctggacccgtatc
tatcgtgttcagcgagacattccgatgccgctggttacttcaggtgtcgagaatggaaac
ctgcgagagctggctttagcgcgcatgaaagattttggtacaacttgtcgagatgtccgt
acgcgcgaggtcggtatcaatgaagtcaagaacaagattcgcccgtctcaggtggagctg
attcgccgcgattatacggcaaatggtggatgggagacgttccttgcgtatgaagaccct
aagcaagacattttgatcggtcttctacgtctgcgcaagtgcagccccacgcacacattc
cgtcccgagttcaccggtcaacaaaccagtatcattcgtgaattgcacgtgtacggttcc
gcggttcctctccacggacgtgacccgcgcaagtttcaacatcttggttttggaactttg
ttgatggaggaggccgagcgaattgcgcgagaagagcacggcagtaccaagatcagtgtc
atctcgggcgtcggcgttcgcagctactatgctcgtcttggatatagcttagacggtcct
tacatgtccaaaatgttggagccaattgaagggggggaatcctga

DBGET integrated database retrieval system