KEGG   Aspergillus nidulans: AN2314.2Help
Entry
AN2314.2          CDS       T01016                                 

Definition
similar to branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ani  Aspergillus nidulans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AN2314.2
Enzymes [BR:ani01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AN2314.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN2314.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 686 aa AA seqDB search
MTSTAPSDGTGIIDLDPWLEPFREAIKRRFDYVESWIKTVDEVEGGLDKFSKGYEKFGFN
VSETGDITYREWAPNAIEAALVGDFNNWDTKANPMTRDNFGVWEIALPAKNGTPVIPHDS
KVKITMVTRSGERIYRIPAWIKRVVQDLNVSPIYESVFWNPPKAERYNFQHARPKKPESL
RIYEAHVGISSPDTRVATYKEFTANMLPRIKYLGYNAIQLMAIMEHAYYASFGYQVNNFF
AASSRYGKPEDLKELVDTAHSMGLVVLLDVVHSHASKNVDDGLNMFDGSDHLYFHSGSKG
QHELWDSRLFNYGNHEVLRFLLSNLRFWMEEYGFDGFRFDGVTSMLYTHHGIGTVSGFSG
GYHEYFGPAVDDDGVMYLALANEMLHRLYPDCITVAEDVSGMPALCLPHGLGGVGFDYRL
AMAIPDMYIKLLKEKSDNDWDIGNLAFTLTNRRHGEKTIAYAESHDQALVGDKSLMMWLC
DKEMYTHMSVLTEFTPVIERGMALHKMIRLVTHALGGEGYLNFEGNEFGHPEWLDFPRAG
NNNSFWYARRQLNLTEDHLLRYRFLNEFDRAMQLTESKYGWLHAPQAYISLKHEGDKVLV
FERADLLWIFNFHPTESFTDYRVGVEQAGTYRVVLDTDDQAFGGLGRIDQGTRFFTTDME
WNGRRNYLQVYIPTRTALALALEETL
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgacttccacagctccatctgacggcactggtatcatcgatcttgatccgtggttagag
ccttttcgggaggctatcaagcgccgattcgattatgttgagagctggatcaagaccgtt
gatgaggtggagggaggtctcgataagttcagcaagggctatgagaaattcggcttcaat
gtcagcgagacgggcgacatcacctacagggaatgggctccaaacgccatagaagcggcg
ctggtgggtgacttcaacaattgggataccaaggcgaatccaatgacgagagacaacttc
ggtgtttgggagattgcccttcctgcgaagaatggcacgccggtcataccgcatgatagt
aaggttaagataactatggtcacccgcagcggagaacgtatatatcgtattcccgcatgg
atcaagcgtgttgtgcaagatctgaatgtatcgcctatctacgaatctgtcttttggaac
ccaccaaaggcagagcggtataactttcagcatgcgcgccctaagaaacccgaaagccta
cggatctatgaagctcacgtcggtatctcgtccccggataccagagtagcaacatacaag
gagttcacagccaacatgctccctcggattaagtacctaggctacaacgcaatccagctc
atggccattatggaacatgcctactatgccagcttcgggtaccaggttaacaatttcttc
gcagcgagtagtcgctacggtaagcccgaggatctgaaggaactggttgacacggcacat
agtatgggcttggtagttctcctcgacgtggtgcacagccacgcatcgaagaacgtcgat
gacggactgaacatgtttgatggcagtgaccatttatatttccattccgggtcaaaaggt
cagcacgagctatgggacagccgactgtttaactacggaaaccatgaagttctgcggttc
ctccttagcaatcttcgcttttggatggaggaatacggctttgacggttttcgatttgat
ggtgtcaccagcatgttatatacccatcacggtattgggactgtcagtggcttttcaggc
ggataccacgaatacttcggtccagcagttgacgacgatggcgttatgtacctagcccta
gcaaacgaaatgctgcaccgtctttacccagattgcataaccgtggcagaggatgtttcg
ggaatgccagcgttatgcctaccacacggccttggtggagtcggattcgactatcgtctc
gcgatggccattccagatatgtatatcaagcttctaaaagagaagtcagacaacgattgg
gacattggcaatctcgccttcacgttgacaaaccgacgccatggcgagaagaccattgca
tacgcagaaagccacgaccaagctctcgtcggcgacaaatctctcatgatgtggctctgc
gataaagaaatgtacacacacatgtccgtcctgacagagttcacccccgtcatcgaacgc
ggcatggcactccacaaaatgatccggcttgtcacacacgcccttggtggcgaaggctac
ctcaatttcgaaggtaacgaattcgggcaccccgaatggctcgactttccccgcgccggc
aacaacaactccttctggtacgcacgtcgccaactaaacctgaccgaagatcaccttcta
cgctacagattccttaacgagttcgaccgcgccatgcagttgacagaatccaagtacggc
tggctccatgcgccccaggcttatatttctctcaagcacgaaggagataaagtgcttgtc
tttgagcgggcggatttgctatggattttcaatttccatcctacggagagttttaccgat
tatagggtcggtgtagaacaagctgggacttatcgggttgtgcttgacactgatgaccag
gcgtttgggggcttgggaaggatcgatcaggggactagattctttacaaccgatatggaa
tggaatgggaggaggaattacttgcaggtttatattccgactaggactgctctggcccta
gcattggaagagacgctgtaa

DBGET integrated database retrieval system