KEGG   Aspergillus nidulans: AN2446.2Help
Entry
AN2446.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ani  Aspergillus nidulans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AN2446.2
   00240 Pyrimidine metabolism
    AN2446.2
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AN2446.2
   03410 Base excision repair
    AN2446.2
   03420 Nucleotide excision repair
    AN2446.2
   03430 Mismatch repair
    AN2446.2
   03440 Homologous recombination
    AN2446.2
DNA repair and recombination proteins [BR:ani03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      AN2446.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 195 aa AA seqDB search
MPPARRRGGNTASARSNQPVLSFGAKSRVTKPSAAPSTPSEKTKALEHLTAEVREKDVSK
DVSIDVPGSKVEPEQPHVAELAVRAQAKAEIQQPLSEEDKKAAKVTRKQLQDYWKAEEAK
SRGPRVHQEGLSLDEKILRHFDLSSQYGPCIGIARLKRWRRAHSLNLNPPIEVLSLLLKQ
EGTAGQRAYIDELLS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgcccgtcgtcgaggaggcaacaccgcctccgcccgttcaaatcagcccgtt
ctatcctttggggcaaagtccagagtcacaaagccgtccgctgcgccttcgacaccgtcc
gagaaaaccaaagccctcgagcaccttactgcagaagttcgcgagaaggatgtgtcgaaa
gatgtgtcaatcgatgtcccgggatccaaggtcgagcccgagcagcctcatgttgcggag
cttgctgtgagggctcaagccaaagcagaaatccagcaaccattatcggaggaggataag
aaagcggccaaagttactaggaagcagcttcaagattactggaaggcagaagaggcgaag
agtcgagggcctagagttcatcaagagggcctatcgttggacgaaaagatcttgcggcat
tttgatctttctagccagtatgggccttgcatcgggatcgcccgtctaaagcgatggagg
cgggcacactccctcaatctcaaccctccaatagaggtactctcactcctccttaagcag
gaaggcaccgctgggcagcgcgcatacatcgacgaactgttgtcatga

DBGET integrated database retrieval system