KEGG   Aspergillus nidulans: AN2484.2Help
Entry
AN2484.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
ani  Aspergillus nidulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 260 aa AA seqDB search
MGSGQFDKAAILSPDFSGVEASSPGFTISPQEIQGIGSAFGDSTWAMQNGVTIGGEKFLA
IKADDQSVYGKKGKEGVVIVRTPSCIMIGHHTEAVQTTNAAAAIEKTPVTGQIFACLCCN
LLLVMVVHFRLVIGRDYDIVIICNIDIIEEHHSGLHNFGCWTYISHCKPGTANRLVTVGG
NGLAAWTYNERSKNINTPPNRNSPPTLARLLATRNREGQNSSAKSRIRRGALKQRLEASG
SAKRRLNIPPEQNMTPISFI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggatccggccaatttgacaaagccgccatcctcagccctgacttctccggcgttgag
gcttcgtctcccggcttcacgatctcgccccaggaaatccaaggtatcggatctgccttt
ggtgacagcacctgggccatgcagaacggtgtcacaatcggtggagagaagttcctcgct
attaaagctgatgaccagagtgtttacggcaagaagggcaaggagggcgttgtcattgtg
aggacaccttcctgcatcatgatcggccaccacaccgaggccgtccagaccaccaacgcc
gctgctgccattgagaagacaccggtcactggtcaaatattcgcgtgcttatgttgcaat
ttgcttctggttatggtcgtgcatttccgtttggttattggtagggactatgatattgtt
attatttgtaatatagacattatcgaagagcaccactcaggccttcacaacttcggttgt
tggacgtacatttcccattgcaagcctggaacagcgaatcggttagtgacggttgggggc
aatgggctggctgcgtggacatacaatgagcggtcgaagaacatcaatacgcctccgaat
agaaatagccctcctacgctcgcgcgactgttagcgactcggaacagggaagggcagaac
agcagcgcaaaaagtaggatacggcgcggcgcattgaaacagaggttggaggcgtcagga
agtgctaagagacggttgaacataccaccggagcagaatatgacaccaatttcttttatt
tga

DBGET integrated database retrieval system