KEGG   Aspergillus nidulans: AN2497.2Help
Entry
AN2497.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ani  Aspergillus nidulans
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AN2497.2
  Lipid metabolism
   00062 Fatty acid elongation
    AN2497.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     AN2497.2
Lipid biosynthesis proteins [BR:ani01004]
 Fatty acid synthase
  Component type
   AN2497.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 323 aa AA seqDB search
MRPLAYTSLVALPLLTAAFPASPASSEFTPLPLVIWHGLGDDYTRSGLRQVASLAESTNP
GTYVHIIHIGDSASSDRQATFLGNVTEQLSTVCAQLAAEPILSTAPAINALGFSQGGQFL
RAYVERCNNPPVRNLVTFGSQHNGIFEFQACSWGDFVCRGAEALLRVGRWSNLVQSRFVP
AQYFRDPAELGEYLENSNFLADVNNERVLKNATYKKNLSTLNRFAMFMFEDDTIVHPKES
SWFAEVNTTTGEVTPLRERDIYKEDWLGLRVLDEKGALDFKTLSGEHMQLAEEDLVEVFE
KYFGPVEVDLPPAQFHLVNQEGY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagacccctagcatatacctctctcgtcgccttacctttactcactgccgcctttcct
gcatccccggcctcctccgaattcactcctctcccgcttgtgatctggcacgggcttggc
gacgactacacccgctcaggccttagacaagttgcatcgctcgcagaatcaaccaaccca
ggaacatatgtacatataatccatattggggactccgcatctagtgatcgtcaagccaca
tttttagggaacgtcacagagcaactatccaccgtctgtgcccagcttgccgccgaacca
attctctccactgcgcccgcaatcaatgctttaggcttctcacagggcggacagtttcta
cgcgcatacgtcgagcgatgcaataaccctccagtccgcaacctcgtcacctttggcagc
cagcataacgggatttttgagttccaggcgtgcagctggggcgactttgtctgccgggga
gccgaggcccttctgcgtgtcggacggtggtcgaatcttgtgcaatcgcgcttcgtcccg
gcgcagtacttccgagatcccgcggagctaggcgagtacttggagaatagcaacttcctg
gcggatgtgaataacgagcgggtgctgaagaatgcgacttacaagaagaacttgagcacc
ttgaatcgctttgccatgttcatgtttgaggatgatactattgtgcatccaaaggagagc
tcctggtttgccgaggtgaacacgactaccggggaagtgacgcccttgcgggagagggac
atctacaaggaggattggctggggctgagagtgttggacgagaagggagcattggatttc
aagacgctgtcgggggaacatatgcagttggctgaggaggacttggttgaggtgtttgag
aagtattttgggcccgtggaggtcgatcttccgcctgcgcagtttcacctagtgaaccag
gaggggtactag

DBGET integrated database retrieval system