KEGG   Aspergillus nidulans: AN2497.2Help
Entry
AN2497.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ani  Aspergillus nidulans
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ani01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ani00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 323 aa AA seqDB search
MRPLAYTSLVALPLLTAAFPASPASSEFTPLPLVIWHGLGDDYTRSGLRQVASLAESTNP
GTYVHIIHIGDSASSDRQATFLGNVTEQLSTVCAQLAAEPILSTAPAINALGFSQGGQFL
RAYVERCNNPPVRNLVTFGSQHNGIFEFQACSWGDFVCRGAEALLRVGRWSNLVQSRFVP
AQYFRDPAELGEYLENSNFLADVNNERVLKNATYKKNLSTLNRFAMFMFEDDTIVHPKES
SWFAEVNTTTGEVTPLRERDIYKEDWLGLRVLDEKGALDFKTLSGEHMQLAEEDLVEVFE
KYFGPVEVDLPPAQFHLVNQEGY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagacccctagcatatacctctctcgtcgccttacctttactcactgccgcctttcct
gcatccccggcctcctccgaattcactcctctcccgcttgtgatctggcacgggcttggc
gacgactacacccgctcaggccttagacaagttgcatcgctcgcagaatcaaccaaccca
ggaacatatgtacatataatccatattggggactccgcatctagtgatcgtcaagccaca
tttttagggaacgtcacagagcaactatccaccgtctgtgcccagcttgccgccgaacca
attctctccactgcgcccgcaatcaatgctttaggcttctcacagggcggacagtttcta
cgcgcatacgtcgagcgatgcaataaccctccagtccgcaacctcgtcacctttggcagc
cagcataacgggatttttgagttccaggcgtgcagctggggcgactttgtctgccgggga
gccgaggcccttctgcgtgtcggacggtggtcgaatcttgtgcaatcgcgcttcgtcccg
gcgcagtacttccgagatcccgcggagctaggcgagtacttggagaatagcaacttcctg
gcggatgtgaataacgagcgggtgctgaagaatgcgacttacaagaagaacttgagcacc
ttgaatcgctttgccatgttcatgtttgaggatgatactattgtgcatccaaaggagagc
tcctggtttgccgaggtgaacacgactaccggggaagtgacgcccttgcgggagagggac
atctacaaggaggattggctggggctgagagtgttggacgagaagggagcattggatttc
aagacgctgtcgggggaacatatgcagttggctgaggaggacttggttgaggtgtttgag
aagtattttgggcccgtggaggtcgatcttccgcctgcgcagtttcacctagtgaaccag
gaggggtactag

DBGET integrated database retrieval system