KEGG   Aspergillus nidulans: AN2621.2Help
Entry
AN2621.2          CDS       T01016                                 

Definition
ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine synthetase) (ACV synthetase) (ACVS)
Orthology
K12743  
N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase [EC:6.3.2.26]
Organism
ani  Aspergillus nidulans
Pathway
Penicillin and cephalosporin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AN2621.2
Enzymes [BR:ani01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.26  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
     AN2621.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 3770 aa AA seqDB search
MSPPGLLSEDGPGYSGGYADPTVPKVNWKQSNGKSAGGNGDVDAGNGNIDPSKSGVGVQV
CFAGGLEGWKAGISKITERCDLSSIATNSTKYQLAVTGFSDGPDDYNEYSVPFPSEVLVA
MEEMCLARDISMRSVIQFAVHYVLKGFGGGSHTVAASIDVGDDPNNIATSYTITPSIVCH
ESRQGQTVMQEIQSMEKLNQLRKQEMHPGEAGLSLIRMGLFDILVIFADANKCEGLIAGL
PLAVMVCEGGGRLQVRIHFSGSLFRQKTLVDIAEALNVLFAKAASGGATPVRDLELLSAE
QKQQLEEWNKTDGEYPECKRLNHLIEEATQLHEDKVAIVYKRRQLTYGELNAQANCFAHY
LRSIGILPEQLVALFLEKSENLIVTILGIWKSGAAYVPIDPTYPDERVRFVLEDTQAKVI
IASNHLAERLQSEVISDRELSIIRLEHCLSAIDQQPSTFPRANLRDPSLTSKQLAYVTYT
SGTTGFPKGILKQHTNVVNSITDLSARYGVTGDHHEAILLFSAYVFEPFVRQMLMALVNG
HLLAMVDDAEKYDAEKLIPFIREHKITYLNGTASVLQEYDFSSCPSLKRLILVGENLTES
RYLALRRHFKNCILNEYGFTESAFVTALNVFEPGSARNNTSLGRPVRNVKCYILNKSLKR
VPIGATGELHIGGLGISKGYLNRPDLTPQRFIPNPFQTDHEKELGLNQLMYKTGDLARWL
PNGEIEYLGRADFQIKLRGIRIEPGEIESTLAGYPGVRTSLVVSKRLRHGEKETTNEHLV
GYYVGDNTSVSETALLQFLELKLPRYMIPTRLVRVSQIPVTVNGKADLRALPSVDLIQPK
VSSCELTDEVEIALGKIWADVLGAHHLSISRKDNFFRLGGHSITCIQLIARIRQQLGVII
SIEDVFSSRTLERMAELLRSKESNGTPDERARPQLKTVAGEVANANVYLANSLQQGFVYQ
FLKNMGRSEAYVMQSVLRYDVNINPDLFKKAWKQVQHMLPTLRLRFQWGQDVLQVIDEDQ
PLNWWFLHLADDSALPEEQKLLELQRRDLAEPYDLAAGSLFRIYLIEHSSTRFSCLFSCH
HAILDGWSLPLLFRKTHGTYLHLLHGHSLRTLEDPYRQSQQYLQDHREDHLRYWAGIVNQ
IEERCDMNALLNERSRYKIQLADYDKVEDQQQLTLTVPDASWLSKLRQTCSAQGITLHSI
LQFVWHAVLHAYGGGTHTVTGTTISGRNLPVSGIERSVGLYINTLPLVINQLAYKNKTVL
EAIRDVQAIVNGMNSRGNVELGRLQKNELKHGLFDSLFVLENYPILDKSEEMRQKSELKY
TIEGNIEKLDYPLAVIAREVDLTGGFTFTICYARELFDEIVISELLQMVRDTLLQVAKHL
DDPVRSLEYLSSAQMAQLDAWNATDAEFPDTTLHAMFEKEAAQKPDKVAVVYEQRSLTYR
QLNERANRMAHQLKSDISPKPNSIIALVVDKSEHMIATILAVWKTGGAYVPIDPEYPDDR
IRYILEDTSAIAVISDACYLSRIQELAGESVRLYRSDISTQTDGNWSVSNPAPSSTSTDL
AYIIYTSGTTGKPKGVMVEHHGVVNLQISLSKTFGLRDTDDEVILSFSNYVFDHFVEQMT
DAILNGQTLVMLNDAMRSDKERLYQYIETNRVTYLSGTPSVISMYEFSRFKDHLRRVDCV
GEAFSQPVFDQIRDTFQGLIINGYGPTEISITTHKRLYPFPERRTDKSIGQQIGNSTSYV
LNADMKRVPIGAVGELYLGGEGVARGYHNRPEVTAERFLRNPFQTDSERQNGRNSRLYRT
GDLVRWIPGSNGEIEYLGRNDFQVKIRGLRIELGEIEAVMSSHPDIKQSVVIAKSGKEGD
QKFLVGYFVASSPLSPGAIRRFMQSRLPGYMIPSSFIPISSLPVTPSGKLDTKALPTAEE
KGAMNVLAPRNEIESILCGIWAGLLDISAQTIGSDSDFFTLGGDSLKSTKLSFKIHEVFG
RTISVSALFRHRTIESLAHLIMNNVGDIQEITPVDYDNRRKIAVSPAQERLLFIHELEGG
GNAYNIDAAFELPPYIDQSRVEEALYTILSRHEALRTFLLRDQATGTFYQKILTTDEAKC
MLIIEKSAVSTIDQIDSIVGRLSQHIFRLDSELPWLAHIVTHKTGNLYLTLSFHHTCFDA
WSLKIFERELRVFCASNEKGGNMPILPMPQVQYKEYAEHHRRRLGKNQIQKLSDFWLQRL
DGLEPLQLLPDYPRPAQFNYDGGDLSVILDGVVLETLRGIAKDHGVTLYAVLLAVYCLML
STYTHQVDIAVGVPISHRTHPLFQSIVGFFVNMVVVRVDVKDFAVHDLIRRVMKALVDAQ
LHQDMPFQDVTKLLRVDNDASRHPLVQTVFNFESDMDKEFETTPSIQDTATIAPYQSVQR
IKSVAKFDLNATATESGSALKINFNYATSLFRKETIQGFLETYRHLLLQLSYLGSQGLKE
DTKLLLVRPEEMSGPHLPLAGLSNGAETLEAISLSRAFEFEAFRVPDRAAVVQGDKSLSY
TELNKRANQLARYIQSVAHLRPDDKVLLILDKSIDMIICILAIWKTGSAYVPLDPSYPKE
RVQCISEVVQAKILITESRYASAWGSQTSTILAIDSPKVSNMVNNQATHNLPNIAGIKNL
AYIIFTSGTSGKPKGVLVEQGGVLHLRDALRKRYFGIECNEYHAVLFLSNYVFDFSIEQL
VLSIMSGHKLIIPEGEFVADDEFYITANGQRLSYLSGTPSLLQQIDLARLNHLQVVTAAG
EQLHAAQFNKLRSGFRGPIYNAYGITETTVYNIVSEFSAQSQFENALRELLPGTRAYLLN
HATQPVPMNAVGELYLAGDCVARGYLNQPVLTGDRFIQNPFQTEQDIASGSYPRLYRTGD
LFRCRLDRQHQPYLEYLGRADLQVKIRGYRIEPSEVQNVLASCPGVRECAVVAKYENTDA
YSRIAKFLVGYYTPDTETVSDSSILAHMKSKLPAYMVPKYLCRLEGGLPVTINGKLDVRK
LPDIGNPQHQISYNPPRDVLEADLCRLWASALGTERCGIDDDLFRLGGDSITALHLAAQI
HHQIGRKVTVRDIFDHPTIRGIHDNVMVKLVPHNVPQFQAEQQTVLGDAPLLPIQTWFLS
KSLQHPSHWNHTFYLRTPELDVTTLSTAVAELQLYHDAFRMRLRQIDGRTVQCFADDISP
VQLRVLNVKDVDGSAAIDQQLQKYQSDFDLEKGPICAAAYLHGYEDRSARVWFSVHHIII
DIVSWQILARDLQILYEGGTLGRKSSSVRQWAEALQSYQGSASERAYWEGLLAQTAANIS
ALPPVTGTRTRLARTWSDDRTVILLNEASNQNASIQDLLLAAVGLALQQVTPGSPSMITL
EGHGREEIVDPTLDLSRTLGWFTSMYPFEIPPLNVETLSQGIASLRECLRQVPARGIGFG
SLYGYCKHQMPQVTFNYLGQLTSKQSITDQWALAVGDGEMQYGLTTSPADRDQSSFAVDI
TASCVNGALSVEMNSAWSLEKSMRFISRIEEVLNMILSGTLAQQATPVLTPQVFNEEMYT
PYFEFSKTPRRGPILFLLPPGEGGAESYFNNIVKHLPTTNMVVFNNYYLHSKSLNTFEKL
AEMYLGHIRQIQPDGPYHFIGWSFGGTIAMEISRQLVGLGSTIGLLGIIDTYFNVPGATR
AIGLGDTEVLDPIHHISQPEPADFQCLPASTDYIILFKATRVNDKFQSENQRRLYEYYDK
TLLNDLDWLLPGASNIHLVRLEEDTHFSWATNPRQIAHVCSTIEKFLARY
NT seq 11313 nt NT seq  +upstreamnt  +downstreamnt
atgagccctcccgggctattgagcgaagacggccctggctacagtggcggctatgcagac
cctacggtgccaaaggttaattggaagcagtccaatgggaaaagcgccgggggcaatggc
gacgttgatgcaggcaatggcaacattgaccctagcaaatcgggtgttggtgtccaagtg
tgttttgcaggagggcttgaaggttggaaagccggcatcagcaaaataactgaacgttgt
gatctgagcagtattgcaacaaactcgacgaaataccagcttgcggtaaccgggttcagt
gatggaccggatgactacaatgagtactcggttccttttccctcagaagtacttgtcgcg
atggaagaaatgtgtcttgcacgagatattagtatgaggtctgtgatccagtttgcagtg
cattatgtgttgaaagggttcggtggtggctcacatactgttgctgcgtcgatcgatgtg
ggtgacgaccccaataacatagcgacatcatacactattacaccctcaattgtctgccat
gagagcagacaaggacagaccgtgatgcaggagattcagagtatggaaaagttaaaccaa
ttgaggaagcaagaaatgcatccgggggaggctggattaagtctcatcagaatggggtta
ttcgacattctggttatcttcgcagatgcaaacaagtgtgagggtctaattgctggcttg
cctctagcagtaatggtgtgcgaaggaggtggaagacttcaggttagaatacacttctca
gggtccctttttcgacagaagacgttagtggatatcgccgaagccctgaacgtcttgttc
gctaaggctgcgtcggggggagcgacgccggtccgagatcttgaacttctttctgcagag
caaaagcagcagttagaagagtggaacaagacggatggagagtaccctgaatgcaaaaga
ctcaatcaccttattgaggaggcgacacagctgcatgaagacaaagttgccatcgtgtac
aaacgtcgccagcttacatacggcgaattgaacgcgcaggccaactgtttcgcgcactat
ctgcggtccatcgggatcttacctgagcagctggtggctttatttctcgagaagagcgag
aaccttatcgtgactatattgggtatctggaagtccggcgccgcatatgtgcccattgac
ccaacctaccctgatgaacgagtccgctttgtgcttgaagacactcaggcaaaagtcatc
attgcgagcaaccaccttgcagagagacttcaaagcgaggtcatcagcgacagggagctc
tccattattcgtctagagcattgcttgagcgccattgatcagcagccatcgacattcccg
agagccaatttgcgcgacccatctctgaccagcaagcagcttgcctacgttacctataca
tcggggaccacgggttttccgaagggcattctcaagcaacacactaacgtggtgaacagc
atcactgacctttcagctcggtatggggtgacaggggaccatcatgaagccatcctgctc
ttttcagcgtatgtgtttgagcccttcgtgcggcagatgctcatggcactagtgaatggc
catttgctcgctatggtcgatgatgctgagaagtatgatgccgaaaagttgataccattc
attcgtgagcacaagatcacgtacctcaacggcactgcctccgtcctgcaggaatacgac
ttctcctcttgcccatctctaaagcgtttgatcttggtcggtgagaacttgactgaatct
cggtatctggcactacgtagacatttcaagaattgcatattgaacgagtatggcttcaca
gaatcagcctttgtgacggcgctcaatgttttcgaaccaggctcggcgcgcaataacacg
agtcttgggaggccggtgcgcaacgtcaagtgttatatcctcaacaagtctctcaagcga
gtgcctattggtgccactggtgaattacacattggcgggctgggtatatccaagggctac
cttaaccgtcccgaccttacgccgcaacgcttcattcccaacccattccaaacggaccat
gagaaggagctcggattaaaccagctgatgtacaagaccggggatctcgcccgttggctt
ccaaacggtgagatcgagtacctcggccgcgcggacttccaaatcaagctgcgagggatc
cgtatcgagcccggcgagatagagtccactctggcgggttaccctggggtacgaaccagc
ctagtcgtctctaaaaggttgcggcatggcgaaaaggagactaccaacgagcatctggta
ggctattatgtgggcgataatacctctgtctctgaaacggctctcttgcaatttctggag
ctgaagctgccccgatacatgattccgacacgacttgtgcgcgtgtctcaaatcccagtg
actgttaatggaaaggcagacctccgtgccctaccttctgtcgaccttattcaacccaaa
gtgtcctcttgcgagctcacggatgaggtggaaatagctttggggaagatatgggcagat
gttctcggagcccatcacctgtcgatatcccgtaaagacaacttctttcgtcttggaggg
cacagcatcacatgcatccagctcatcgcacgtattcgccagcagcttggtgtaattatt
tccattgaggacgttttctcatcccggacactggagcgtatggctgagcttctgcgaagc
aaagagtccaacggaactccggatgagagggctaggcctcaactaaaaaccgtggcggga
gaagttgcaaatgctaatgtctatcttgctaacagtctccagcaaggcttcgtttatcag
ttcctgaaaaatatgggccgatcagaggcttatgtgatgcaatccgtgctgcgatacgat
gtcaatatcaatcctgatctatttaaaaaagcctggaagcaggtacaacacatgcttcca
acactgaggctccgatttcaatggggacaggatgttttgcaggtgattgacgaggaccag
ccgctgaactggtggttcttacaccttgccgacgattcagccctgcccgaggagcagaaa
ctactagagttacagcgcagggacctggctgagccatacgacctagcagccggaagcctg
ttccgcatttatctgatcgagcatagctcaactcggttttcgtgcttgttcagctgtcat
cacgcaatccttgatggatggagcctgccgcttcttttcaggaagactcatggaacttat
ctgcatctcctgcacggacattctctcaggactctggaagacccttacaggcagtctcag
cagtatctccaagatcatcgcgaagatcatctcaggtactgggctggtatcgtgaatcag
attgaagagcgttgtgacatgaacgctttgctgaacgaacgcagtcggtacaagattcaa
ctggcggactatgacaaagtggaggatcaacaacaattaactttaacagtccctgatgct
tcctggctaagcaaattgcgccaaacatgctctgcgcaaggcattacattgcactctatt
ctgcagtttgtttggcacgcggtattgcatgcttacggtggcggtactcatactgtcact
ggcactactatctcagggaggaacctgcctgtgagtgggatcgaacgatctgtgggtctc
tacataaatacgctcccactggtaattaatcagttggcctataagaataaaaccgtcttg
gaggctatccgtgatgtgcaggccattgtaaatggcatgaacagccggggaaatgtggaa
cttggccgtctacagaaaaacgagctgaagcatgggttatttgactcgctatttgtgctg
gagaattatccaatactggacaagtccgaggagatgcggcagaagagtgaattgaagtat
accatcgaaggcaatattgaaaagctcgactatccccttgctgttatcgcgcgcgaggtc
gacctaactgggggattcaccttcaccatctgctacgctcgagagcttttcgatgagatt
gttatatctgagttgctccaaatggtccgggacacgctcctgcaagtcgcgaagcattta
gatgaccccgtccgcagcctagagtatctgtcatcagcgcaaatggctcaacttgacgca
tggaatgcgacagacgcggaattccccgacaccaccctacacgcgatgttcgaaaaagaa
gcggcccagaaaccagacaaggtcgcggtggtctatgagcaacgcagcttgacgtatcgt
cagctaaatgagcgggcgaaccgtatggcgcaccagctcaaatctgatatcagcccaaag
ccgaacagtatcattgctctggtagtggataagagtgagcatatgatagctaccattctg
gctgtgtggaagactggcggtgcctatgtaccgatcgaccctgagtaccccgacgaccgt
atccgctatatcctagaagacaccagcgccattgccgtgatttcagacgcgtgttacctc
tcacgaatccaagaattagcgggagagagtgtccgtctgtatcggtctgacatctctact
cagactgacggtaactggagtgtgtcgaatcctgcaccgtccagtacgagcacggatctt
gcatatattatctacacttcgggaacaactgggaagccaaagggcgtcatggtggagcac
cacggagtggtaaatctgcagatatcgctgtctaaaaccttcgggctgcgcgatactgat
gacgaggtaatcctctcattctccaactacgtctttgaccatttcgtggaacagatgacg
gatgccattctcaacggccaaacattagttatgctcaacgatgcaatgcgcagtgacaaa
gagcgcctctaccaatatatcgaaactaatagggtaacatacctgtctggaaccccatcc
gttatttccatgtatgagttcagtcgatttaaagaccacctacgccgtgtcgactgcgtt
ggagaagcttttagccagcccgtctttgatcaaatccgtgacactttccaagggctgatt
atcaacggctacggtccaacagagatctccatcacgacacacaagcggctgtaccctttc
cctgagcggcgcacagataagagcatcggccagcagattggcaacagtacgagctacgtg
ctgaatgcagacatgaaacgcgttccaattggggctgtaggtgagctctatctgggtggt
gaaggcgtcgcgcgaggatatcataaccgaccggaagtgactgctgagcgatttttacgc
aatccgttccaaacagacagtgaacggcaaaatgggcgcaacagccgcttgtacaggacc
ggtgacttggtacgctggatcccaggcagtaacggtgaaattgaatatttgggacgcaat
gacttccaggtcaagattcgcgggctccgtatcgaattgggggagattgaggctgtcatg
tcctcacatcctgacattaaacagtctgttgtaattgcaaagagtggcaaggaaggagac
cagaagttccttgttggttacttcgtggctagctcgccattgtctccgggtgcaatccgg
cgctttatgcaatcccggcttcctggctatatgataccttcaagtttcattcctatcagt
tctctcccagtgactcccagtggaaagctggatacaaaggccttacctacagcagaggag
aaaggcgcaatgaacgtgctggctccacgtaatgaaatcgagagcatcctgtgcggtatc
tgggcagggttgttagatatatccgcccaaacaattggcagcgacagcgattttttcacc
ctcggaggcgatagtttgaagagtacaaagctctcattcaagattcacgaggtatttggc
cgcacaatctccgtcagcgctctgttccgtcaccgaaccatcgagagtctggcacaccta
attatgaacaatgttggagacatacaggagatcacgcctgtggattatgataacagacgc
aaaatagccgtatctcccgctcaagagcgccttctattcattcacgagcttgaaggtgga
ggcaatgcatataatatcgatgctgcctttgagctacctccatacattgatcaatctcga
gtcgaagaggcattatataccattctttcaagacacgaagccttacgaacatttctgctg
cgggaccaggcaactggcacgttctaccaaaagatattgactaccgatgaggccaagtgc
atgttgatcattgagaaaagtgcagtgagcaccattgatcaaattgattccatagtcgga
cgcctatcgcagcacattttccgtctcgattctgagcttccctggttggcgcatattgtc
acgcacaaaacgggcaatctttatctgaccctgtccttccatcacacttgcttcgatgca
tggtcattgaagatcttcgagcgggagctccgcgttttttgcgcgtcaaacgaaaaaggc
ggcaacatgccaatcctaccaatgcctcaagtccagtacaaggagtatgccgagcaccat
cgtcgacgactaggtaagaatcagattcaaaaattatccgacttttggctgcaaagacta
gacggcctggagcccctacagctcctaccggattatccgcggcctgcccaattcaactac
gatggaggtgacctctccgtcattctggacggtgtggttctggaaaccctcaggggcatt
gcaaaagaccacggagtaactctgtacgcagtgcttctcgctgtttactgcctgatgctt
tcgacatatacacaccaggtagatatcgctgtgggagtccccatcagtcaccgaacccac
cccctgttccagtctattgtcggattcttcgtcaatatggtagttgtgagggtcgacgtg
aaggactttgccgttcacgatctcattcgaagggtaatgaaagcgcttgttgatgcccag
ttacatcaggacatgccattccaagacgtgactaaactgctgcgggtggataacgacgcc
agccgacatcccctagttcagactgtgttcaactttgaaagtgacatggacaaagaattc
gagacgacaccttcaatccaagacactgccacaatcgcaccataccagtccgttcagagg
ataaagtcggttgcgaaatttgatctgaacgcgacagctacagagtcgggctcagcctta
aagattaactttaactatgccaccagcctgttccggaaagaaacgatccagggcttctta
gagacatacaggcatctcctgttacagctctcttatctggggtcccagggacttaaagaa
gatacaaagctactgttggtccgccctgaggagatgagtggtccgcatctgccattagca
ggattatccaatggtgcggaaaccctagaagctatatcactcagtagagcattcgagttt
gaagctttcagggtaccggatagagctgccgtcgtacagggagataaatcactcagctat
accgagctcaataaacgggcaaaccagctagcccggtacatacaatccgtggcacacctt
aggccggacgacaaggtgctcctcattctggataagagcatcgacatgattatttgcatc
ctcgcaatctggaaaaccggtagcgcatatgtgcctttggatccatcatatcccaaggag
cgtgtccagtgcatttcggaggtagttcaagcaaagattctgattacagagtcacggtac
gcctctgcatggggaagccagacgtcaacaatacttgcaattgactcgcccaaggtctcg
aatatggtcaataatcaggcaactcataacttgcccaacattgcgggaataaaaaatctg
gcatatataattttcacatctggcacctccggcaagccaaagggtgttctggtcgaacaa
ggtggagttcttcacttgcgtgatgcgcttaggaagcggtactttggcattgaatgcaat
gaataccatgctgtgctcttcctatccaattacgtgtttgatttctctatcgagcagttg
gtcttatcaattatgagcggccacaagttgatcatcccggaaggagaattcgttgcggat
gatgaattctacataacagccaacggtcaacgcctctcatatttgagcggtacaccatcc
ctgttgcagcaaattgacctagcacgcctcaatcatctacaggtcgtaactgcagctggt
gagcaactccatgctgcgcagtttaataagttgcgctccggattccgcggcccgatctac
aacgcatatggaattacggagaccacggtatacaacatagtcagcgagttcagtgcgcaa
tcccaattcgaaaatgctctgcgagagctgctaccaggcactagggcatatcttcttaac
cacgccactcagccagttcctatgaacgcagtcggagagctgtatctcgctggtgattgt
gtggcccgtggctatctcaaccagcctgttctaacaggtgaccgttttatccagaatcca
ttccaaacagagcaagatattgcttccggaagctatcctcggctctatagaactggcgac
ctgtttcgatgccggcttgaccgtcagcaccagccatatctagaatatcttggaagagct
gatctccaggtcaagataagaggataccgtattgagccgtcagaagttcagaacgtgctt
gcttcctgtcctggcgttcgagaatgtgcagtagtggccaagtatgagaacaccgatgct
tactccaggatagccaaattcctggtcggatattatacccctgacaccgagacggtctcc
gattcaagtatcctcgcccacatgaaaagcaagcttcccgcatatatggtccctaaatat
ctatgccgtctagaaggtggacttccagtgacaatcaacgggaaacttgacgttcgaaag
ctgcctgatatcggcaaccctcaacatcaaatatcgtacaaccccccaagggatgtcctg
gaggccgacttgtgtagattatgggcatcagcactaggaacagagcgatgcggtattgat
gatgatctgtttaggttaggcggagacagtattactgctttgcatctcgcagcccaaatc
caccaccagatcggccgaaaggtcactgttcgagatattttcgaccaccctaccattcgt
ggtattcatgacaacgttatggtgaaactcgttccacacaatgttcctcaattccaagca
gagcagcaaacagtactcggtgatgcgcctctgctaccgatccaaacttggttcttatca
aaatcgctacagcacccaagccattggaatcacaccttctacctacggacccctgagctg
gacgtgactactctgagcacagcagtcgccgaattgcagctgtatcatgacgccttcaga
atgcggttgaggcaaatagatggaaggacggtgcaatgcttcgcagatgacatttctcca
gtacagctccgagtgttgaacgtcaaggatgtcgacggaagcgcggctattgaccagcaa
ctccagaaatatcagtctgacttcgaccttgagaaaggcccaatctgtgctgctgcctac
ctccatggctacgaggatcgatctgcacgagtctggttttctgtccaccacatcatcatt
gatatagttagctggcagattcttgcgcgcgacctacaaatcctgtacgagggtggaact
ctcggtcgtaagagtagcagcgtcagacaatgggcagaggcactacagagctaccagggg
tcggcatcggagagggcctactgggaaggacttcttgctcaaacggctgccaacatatcc
gctttgcccccagtgaccgggacccgtacccggttggctcgaacttggagtgacgacagg
acggtcattctcctgaatgaagcttctaatcagaatgcatctatacaagacctcttactc
gccgctgttggattggcacttcaacaggtcaccccgggtagcccgagtatgattactctc
gagggccatgggcgtgaggaaattgttgacccgacattagacctcagccgtaccttgggt
tggttcaccagcatgtatcccttcgagatccctcccctgaatgttgaaacccttagccag
ggcatagccagcttgcgagaatgccttaggcaggtgcctgcacggggcatcgggtttgga
tcactctacggttattgcaaacaccaaatgcctcaggttacgttcaactacctgggccag
ctgacaagcaagcaatcgataactgatcagtgggccctcgctgttggtgacggagagatg
caatatgggcttacaacaagtcctgcggacagagaccaaagctcgttcgcggttgatatc
accgccagctgtgtaaatggtgccctgtcagtcgaaatgaatagtgcctggagccttgaa
aaaagcatgcgattcatatccaggattgaggaagtattgaatatgattcttagcgggacc
ctagctcagcaggcgactccagtgcttacgccacaggtattcaacgaggagatgtacaca
ccatattttgaattttccaaaaccccacgacgcggaccgatcttgttcctattgccgcca
ggggagggaggggcagaaagctactttaacaatatcgtcaagcacttgcccacgactaat
atggtcgtctttaacaattactaccttcactccaagagtctgaacacgtttgaaaagcta
gctgagatgtatttggggcacatccgtcagatccagccagacgggccttaccatttcatc
ggatggagttttggaggaacaatcgcgatggaaatatcgcgacagctcgtggggctaggt
tcaacgattggtcttttaggtatcattgacacgtatttcaacgtgcctggagcaacgcgg
gcaattggcctcggtgatactgaggtcttggatcccattcatcatatatcccaaccagaa
ccagccgatttccagtgcctcccagccagcacagactacatcattttattcaaagctact
agggtgaacgacaagtttcagtctgaaaaccagaggcgtctgtacgagtactacgacaaa
acattgcttaatgatctcgactggttactccctggtgcttcaaacattcatctagtccgc
cttgaggaggatactcacttctcctgggcgaccaatccacgccaaatcgcccacgtttgt
tcaacaatcgagaaatttctcgccagatattag

DBGET integrated database retrieval system