KEGG   Aspergillus nidulans: AN2706.2Help
Entry
AN2706.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ani  Aspergillus nidulans
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AN2706.2
  Amino acid metabolism
   00380 Tryptophan metabolism
    AN2706.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AN2706.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 465 aa AA seqDB search
MLVTLTVLFLGLVGILASFLTYLFTPPQFFPKGLPTIPFYYTLIPLLNQTLKRAPTDQVT
LYHRYLSTPLRTHGAVKLFFGGRWNILITKPSYIAEVLKNEDLYAKSGNQKKIPHSVLAQ
YTGDNIISSHGENWKLYSSIFKPGLQRDYDPSGIWRNASLLVQMISQDIKRKSPVDINPL
MQRYALANLSEVLLGTTFDTLQKPAASLHAFQLLIKPKIFDPIFLNFPVLDYLPLQTREE
ARKLVTRFTDELIETVRKGHTTCDHEKEHTRNLGCRLLYACESGLFTEMQLRHNMISAFL
AGHENPQLLLVSSLFLLAEHPEMQESLRAEISALNDLEPAYNALSALPLLTSTIYEVLRL
YPPISQLINRRTTAPTLLGGEIPIPAGTYVGYNAYATNRDIGFWGPDANEFKPSRWGNTM
EEINALFRRANAKGAFISFHGGRRTCLGQRFALLEGRVTLAKLLM
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctagtaaccctaacagtcctctttttgggcctcgtcggtattctcgccagcttcctc
acctacctcttcactccaccccagttttttcctaagggtctccccacaatccccttctac
tacacacttatcccgctgctaaatcaaaccctgaagcgggcccccaccgaccaagtcact
ctctaccatcgctacctctctacccctctgagaacccacggcgctgtcaagctatttttt
ggcggccggtggaatatcctcatcacaaaaccgtcctacattgccgaggtcctgaaaaac
gaagatttatatgcgaaaagcggcaatcagaagaaaattccccatagcgttctggcacaa
tacactggggataatattatatcctcgcatggcgagaattggaaactgtacagcagcatc
ttcaagccaggcttgcagcgggattatgatccgtctggaatatggaggaacgcgtccctg
cttgtgcagatgatcagccaggatatcaagagaaagagcccggtggatatcaatccgttg
atgcagcggtatgcattagcaaacctgagcgaggttctgctgggaaccaccttcgacaca
ctgcaaaagccggccgcctctctgcacgctttccagctcctcatcaagcccaagatcttt
gaccccatcttcctcaacttccctgttctagactacctcccccttcaaaccagggaggag
gctagaaaattggtgactaggttcactgatgagcttatcgagacggtccggaagggccac
acaacctgcgaccatgagaaggagcacacgagaaatctaggatgtcgtcttctatatgcc
tgcgaaagtggtctattcaccgaaatgcagctgcgacataatatgatcagcgcgtttctg
gcgggacacgagaacccccagttgttgctggtatcaagtctgttcttgttggctgaacat
ccggagatgcaggaaagcctacgcgcggagatctccgccctcaacgacctggaaccggct
tacaacgctttatctgccttgcccctccttacatccacaatctacgaagtcctccgcctg
tacccaccaatcagccagctgattaaccgccgcacaacggctcccaccctcctcggggga
gagatccccattccagcaggcacatacgtcggctacaacgcgtatgctacaaaccgggat
ataggcttctggggtccagacgccaacgagttcaagccaagccggtggggaaataccatg
gaagaaataaatgcactatttagaagggcgaacgcaaagggcgcgtttattagctttcac
ggcgggcggcgcacttgcttaggacagaggttcgccttgcttgaggggcgagtgacactt
gcgaaattgctaatgtag

DBGET integrated database retrieval system