KEGG   Aspergillus nidulans: AN2723.2Help
Entry
AN2723.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ani  Aspergillus nidulans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ani01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ani00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 438 aa AA seqDB search
MPITLKSANPSSGASNNLSLDVPSIVRSVIEDIRQNGDKALRSYSEKFDKWSPDSFKLSK
EQIDEIVSTVPAQVIEDIKTVQQNVRTFAEEQRKSIRDFEYQIQPGVFLGQKNIPISAVG
AYIPGGRYPLLASAHMTIVTAKAAGVSRVIACTPPIQGKIPASTVAAIHLAGADEIYILG
GVQAIAAMALGTESINKTDFIAGPGNPFVAEAKRQLFGEIGIDLPAGPTEVLIVADAKAD
PFVVATDLLSQAEHGPDTPAILITDSRDVAEKTIKEVERLLPILPTRALAAVSWERFGEV
QLVEDLNEAYKLADEYASEHVQILTENPREALVKMKNYGALFLGEKTCVSYGDKCIGTNH
VLPTKSAARFTGGLWVGKYLKTVTYQEVTDAKASGELGRLCGRAARAEGFEGHARSGDVR
AHNYLSDSFEWLAEPSGV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaccctcaaaagcgccaaccctagcagtggcgcctccaacaacctatccctt
gacgtccctagtatcgtgcgcagtgtgatcgaagacatccggcagaatggcgataaagca
ctgcgctcgtattcagaaaagttcgacaaatggagccccgatagcttcaaactgtccaag
gagcagattgacgagatcgtcagcactgtccccgcacaggtcattgaggatatcaagacc
gtgcagcagaacgtgcggacctttgccgaagagcagcgcaagtccatcagggactttgag
tatcagattcagccgggggtgtttctggggcagaagaatatccccatctctgcggtcggc
gcgtacattcccggcgggcgctaccccctcctcgcctcagcccacatgacaattgtgact
gccaaagccgccggtgtttcgcgtgtcattgcctgtacgccccctattcaaggcaaaatc
ccggcatcgacggtggcggcgatccacctagctggtgcagatgaaatatatatcctcggc
ggcgtgcaagcgattgcggcaatggcattgggaaccgaatctatcaacaagaccgacttc
atcgcaggcccggggaatccgttcgttgcagaggccaagcggcaactcttcggcgagatc
gggatcgacctgcccgccggtccgacggaggtgcttattgtagcggacgccaaagccgat
ccctttgtcgttgcaacagacctgctgtcgcaagcggagcatgggcccgatacgcccgcc
attctgatcacggattcgagggatgttgcggagaagacgatcaaagaggttgaaagactg
ctaccgatccttccgactagggcgctggcggcggtttcatgggagaggttcggagaggta
caacttgttgaggatctgaatgaggcgtacaaacttgcagatgagtatgcgagtgagcac
gttcagattttgacggagaaccctagggaggcgctggtcaagatgaagaactacggggcg
ctcttccttggcgagaagacgtgcgtttcgtatggagataagtgtattggaactaaccat
gttctgcccactaaaagcgcagcgcgcttcactggcggcctctgggtcggcaaatatctg
aagaccgttacctaccaagaggtaacagacgcgaaagccagtggcgaactcggtcgtctg
tgtggccgtgctgctcgggcagaggggtttgaaggccatgctcggtctggagacgttcgc
gctcataattatctgagcgactcgtttgagtggcttgctgaaccaagcggggtttga

DBGET integrated database retrieval system