KEGG   Aspergillus nidulans: AN2723.2Help
Entry
AN2723.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ani  Aspergillus nidulans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AN2723.2
  Amino acid metabolism
   00340 Histidine metabolism
    AN2723.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AN2723.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 438 aa AA seqDB search
MPITLKSANPSSGASNNLSLDVPSIVRSVIEDIRQNGDKALRSYSEKFDKWSPDSFKLSK
EQIDEIVSTVPAQVIEDIKTVQQNVRTFAEEQRKSIRDFEYQIQPGVFLGQKNIPISAVG
AYIPGGRYPLLASAHMTIVTAKAAGVSRVIACTPPIQGKIPASTVAAIHLAGADEIYILG
GVQAIAAMALGTESINKTDFIAGPGNPFVAEAKRQLFGEIGIDLPAGPTEVLIVADAKAD
PFVVATDLLSQAEHGPDTPAILITDSRDVAEKTIKEVERLLPILPTRALAAVSWERFGEV
QLVEDLNEAYKLADEYASEHVQILTENPREALVKMKNYGALFLGEKTCVSYGDKCIGTNH
VLPTKSAARFTGGLWVGKYLKTVTYQEVTDAKASGELGRLCGRAARAEGFEGHARSGDVR
AHNYLSDSFEWLAEPSGV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaccctcaaaagcgccaaccctagcagtggcgcctccaacaacctatccctt
gacgtccctagtatcgtgcgcagtgtgatcgaagacatccggcagaatggcgataaagca
ctgcgctcgtattcagaaaagttcgacaaatggagccccgatagcttcaaactgtccaag
gagcagattgacgagatcgtcagcactgtccccgcacaggtcattgaggatatcaagacc
gtgcagcagaacgtgcggacctttgccgaagagcagcgcaagtccatcagggactttgag
tatcagattcagccgggggtgtttctggggcagaagaatatccccatctctgcggtcggc
gcgtacattcccggcgggcgctaccccctcctcgcctcagcccacatgacaattgtgact
gccaaagccgccggtgtttcgcgtgtcattgcctgtacgccccctattcaaggcaaaatc
ccggcatcgacggtggcggcgatccacctagctggtgcagatgaaatatatatcctcggc
ggcgtgcaagcgattgcggcaatggcattgggaaccgaatctatcaacaagaccgacttc
atcgcaggcccggggaatccgttcgttgcagaggccaagcggcaactcttcggcgagatc
gggatcgacctgcccgccggtccgacggaggtgcttattgtagcggacgccaaagccgat
ccctttgtcgttgcaacagacctgctgtcgcaagcggagcatgggcccgatacgcccgcc
attctgatcacggattcgagggatgttgcggagaagacgatcaaagaggttgaaagactg
ctaccgatccttccgactagggcgctggcggcggtttcatgggagaggttcggagaggta
caacttgttgaggatctgaatgaggcgtacaaacttgcagatgagtatgcgagtgagcac
gttcagattttgacggagaaccctagggaggcgctggtcaagatgaagaactacggggcg
ctcttccttggcgagaagacgtgcgtttcgtatggagataagtgtattggaactaaccat
gttctgcccactaaaagcgcagcgcgcttcactggcggcctctgggtcggcaaatatctg
aagaccgttacctaccaagaggtaacagacgcgaaagccagtggcgaactcggtcgtctg
tgtggccgtgctgctcgggcagaggggtttgaaggccatgctcggtctggagacgttcgc
gctcataattatctgagcgactcgtttgagtggcttgctgaaccaagcggggtttga

DBGET integrated database retrieval system