KEGG   Aspergillus nidulans: AN2799.2Help
Entry
AN2799.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00350  Tyrosine metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AN2799.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     AN2799.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase
Motif
Other DBs
NCBI-GeneID: 2873723
NCBI-ProteinID: XP_660403
UniProt: Q5B9I1 A0A1U8QY06
Position
VI
AA seq 557 aa AA seqDB search
MALSATASATARSSSAGLEERASASYAIDGFFSEGCTEDRMTVRKEWRHLTGPQHQAFLD
ALQCLMEKPAQSGLTATTSRFSDLQALHRGMTNTAYADIIHHVNEQLDADSGNMWQSPMW
GADAFGGNGTGSDISVTDGRFANMTLHIGPGDEDTEYCLRRAWDNENAIANANSTMLYMC
NSYNTYLLAMMADIKSSPGDSVFFMHHMYVDRIWWLWQKQDPINRLYDISGPTLNHTANI
EPAGGWQNATLHYELSSFGIMPNVTIAEVMSTQGGYLCYGVWQTQWVALIQRDSQPLYQR
ALAASSEPRLRPCNLDQTEAILIDLVNWRPDGAMGGTLQEPARLGDSSLPSPPVPSVGDR
PCTGGTQVPAPRTGELTDRLGNAYFAGMKEELNVTGNQYQSFTTMWTMRNAKFRVASFFI
CSENIGSYMNFWLKSLNRYSVSQMNTYPTVTNAITILTSLLYGWTSDLFQIRYPIVFFSL
TIRARSWSGFLTRVNEVCAGDSPERKIILGSTNSIAEGTGNRNRLELEAQNLELGPASAR
RFNLKRGLYVSIACWAG
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtccgccacggctagcgcaactgctcgttcctcatcggcagggctagaggag
cgtgcatcggcctcgtacgctattgacggcttcttcagcgagggatgcaccgaagataga
atgacagtgcgcaaggaatggcgacatctgaccggaccacaacaccaagccttcctcgac
gctcttcagtgtctgatggagaaacctgcacagtccgggctgactgcaacaacaagccgc
tttagtgatttgcaggctctacatcggggtatgacgaatacagcgtatgcagatataatc
caccacgtgaacgagcagctcgacgccgatagcgggaatatgtggcagtcgcccatgtgg
ggggctgatgcattcgggggtaacgggacaggttcagacataagcgtcacggatggccgg
tttgccaacatgaccctccatatcggtcctggagacgaggataccgagtactgcttgcgt
cgggcttgggacaacgagaacgccattgccaacgctaacagtaccatgctatatatgtgc
aattcgtataacacttacttactcgccatgatggcggacatcaagtcctccccgggcgac
tcggttttcttcatgcaccacatgtacgtcgaccggatctggtggctatggcagaagcag
gaccctatcaaccggctgtacgatatcagcgggccgacgttgaaccataccgcgaatata
gagcccgccggtggttggcagaatgcgactctccactatgagctctcttcgtttggaatc
atgccgaatgttaccatcgcagaggttatgagtactcagggcgggtatttgtgttatgga
gtatggcagactcaatgggttgctcttatccaaagagattcccaacctctgtaccaacgg
gctctagcggcctcatcagaacctcgcctcaggccttgcaacttagatcaaactgaagcg
atcttgatcgacttggtcaactggcggcctgacggcgcgatgggtggtactcttcaagaa
cccgccaggctcggagattcctcgcttccgagtcctcctgtgccgagcgtaggtgataga
ccatgtaccggaggtactcaagtcccggctcctcgtaccggtgaactgacggaccgtcta
gggaacgcatacttcgcggggatgaaagaagagctcaacgtcacgggaaaccagtaccag
agtttcactaccatgtggacaatgagaaatgctaagtttcgagtcgccagcttcttcatc
tgctccgagaacatcggcagctacatgaacttttggctgaagagtctgaaccggtactct
gtgtcccagatgaacacgtatcccaccgtcactaacgcgatcacgatcctaacgagtctc
ctctacggctggacgagcgaccttttccagattcggtacccgatcgtctttttctcgctg
acgattcgcgcaaggtcctggtccggttttttgacgagggtcaatgaagtctgcgcggga
gatagtcccgagcgcaagattatcctggggtcaacaaactcgatcgccgaagggaccggc
aaccgcaacagactcgagttggaggcgcagaatctggagctagggccagcgtcagcacgg
cgatttaacttgaaacgaggcttatatgtcagcatagcttgctgggcgggctaa

DBGET integrated database retrieval system