KEGG   Aspergillus nidulans: AN2846.2Help
Entry
AN2846.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ani  Aspergillus nidulans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AN2846.2
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AN2846.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AN2846.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 194 aa AA seqDB search
MASATTFYDFEPVDKKGEAYPLNQLKGKVILVVNTASKCGFTPQFKGLETLYQSIKAKRP
DDFVILGFPCNQFGGQDPGSNDQIQEFCQLNYGVTFPVLGKTEVNGDNANPLWTWLKESQ
PGLLGLKRIKWNFEKFLISADGKVVGRWASTTKPEGLESRILEEIEKAEKQGLLASKAMQ
PEAAGTDGETAKLA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctactacattttatgacttcgagcctgttgacaagaaaggcgaagcttat
cccctcaaccagctaaagggcaaagttatccttgtcgtcaacaccgcgtcgaaatgcggt
ttcacgcctcaattcaaaggcctcgagaccctttaccagtccatcaaagccaagcgcccc
gatgacttcgttatccttggtttcccctgcaaccagtttggcggtcaggacccgggctcc
aacgaccagattcaggaattctgtcaattgaactacggcgttaccttccccgttctcggc
aagacggaggtcaacggagataatgcgaaccctctttggacttggctgaaagagagccag
cctggtctgttggggttgaagaggataaagtggaactttgagaaattcctgatttccgcg
gatggcaaggttgttgggaggtgggctagtaccaccaagcctgagggattggagagcagg
attttagaggagattgagaaggccgagaagcaggggcttctggcttcgaaggctatgcag
cccgaagctgcaggtacggacggggagactgccaagctggcgtaa

DBGET integrated database retrieval system